DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and hoxb8a

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:XP_005171620.1 Gene:hoxb8a / 30343 ZFINID:ZDB-GENE-990415-108 Length:246 Species:Danio rerio


Alignment Length:213 Identity:53/213 - (24%)
Similarity:77/213 - (36%) Gaps:44/213 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 DYHPLNGKLDYSSSPKDQYEP---QQLQHLYGGSPHHLDHLDHGSDGLL---QDSSPVMINGGSA 220
            :|:......|..:.|...|.|   ...||    :|...:...||:..|.   ...||..:.....
Zfish    22 NYYECGFAQDLGTRPTVVYGPGTGATFQH----APQIQEFYHHGASTLSAAPYQQSPCAVTCHGE 82

  Fly   221 GGKLKKPDEMCSQLEAGG--AGVTPPSSSSTVVNGTTNGTGNANSSSS-----AGVGIQGAAGTA 278
            .|.....|.:..|...|.  |.:...|.......|..:.|.|...|.|     ..:..|.|||  
Zfish    83 PGNFYGYDALQRQTLFGAQDADLVQYSDCKLATGGIGDETDNTEQSPSPTQLFPWMRPQVAAG-- 145

  Fly   279 GGVAAPAAKKDGSSSKKKGDPNGIKKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNL 343
                                     :::.|.|::.||..|||:.|...||.....|.|::..|.|
Zfish   146 -------------------------RRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGL 185

  Fly   344 SESRVQVWFQNRRAKWRK 361
            :|.:|::||||||.||:|
Zfish   186 TERQVKIWFQNRRMKWKK 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 21/46 (46%)
hoxb8aXP_005171620.1 Homeobox 150..202 CDD:278475 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.