DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and gsc

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_571092.1 Gene:gsc / 30212 ZFINID:ZDB-GENE-980528-2060 Length:240 Species:Danio rerio


Alignment Length:151 Identity:47/151 - (31%)
Similarity:66/151 - (43%) Gaps:30/151 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 PPSSSSTVVNGTTNGT----GNANSSSSAGVGIQGAAGTAGGVAAPAAKKD-------------- 289
            ||:.:...|||.....    |..:.....|....||..|.|....|.....              
Zfish    55 PPAPNLQSVNGRIGYNNYYYGQLHVQGPTGPACCGAIPTLGSQQCPCIPTGYDSAGSVLISPVPH 119

  Fly   290 --------GSSSKKK----GDPNGIKKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLN 342
                    |:.|:.:    ...:..:|::.||.||..|||.||..|:...||||..||:||.|::
Zfish   120 QMMSYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVH 184

  Fly   343 LSESRVQVWFQNRRAKWRKHE 363
            |.|.:|:|||:|||||||:.:
Zfish   185 LREEKVEVWFKNRRAKWRRQK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 26/46 (57%)
gscNP_571092.1 Homeobox 149..202 CDD:278475 30/52 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 199..240 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.