DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and dharma

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_571054.1 Gene:dharma / 30170 ZFINID:ZDB-GENE-990415-22 Length:192 Species:Danio rerio


Alignment Length:65 Identity:32/65 - (49%)
Similarity:38/65 - (58%) Gaps:5/65 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 PNGIKKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKWRKHE 363
            |.|    :.||.||..|.|:|||.|....||.|..|.|||....|||..|:|||:||||: ||.:
Zfish   114 PRG----RIRTVFTDNQTEQLERLFAVTDYPTVETRAELAQNTGLSEETVRVWFKNRRAR-RKRQ 173

  Fly   364  363
            Zfish   174  173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 24/46 (52%)
dharmaNP_571054.1 Homeobox 119..171 CDD:278475 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.