DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and Rhox11

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001020044.1 Gene:Rhox11 / 298346 RGDID:1564332 Length:215 Species:Rattus norvegicus


Alignment Length:65 Identity:30/65 - (46%)
Similarity:39/65 - (60%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 FTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKWRKHEPPRKTGYIKTST 375
            ||..||.|::..||...|||.|.|:|||..:|:.|.:|:.||.|:|||.||.:.....|.|.|.|
  Rat   103 FTPGQLWEMQAVFEETQYPDAFRRKELAELMNVDEQKVKDWFNNKRAKLRKIQREILKGKIITPT 167

  Fly   376  375
              Rat   168  167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 22/46 (48%)
Rhox11NP_001020044.1 homeodomain 97..155 CDD:238039 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.