powered by:
Protein Alignment repo and Rhox11
DIOPT Version :9
Sequence 1: | NP_477026.1 |
Gene: | repo / 47285 |
FlyBaseID: | FBgn0011701 |
Length: | 612 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001020044.1 |
Gene: | Rhox11 / 298346 |
RGDID: | 1564332 |
Length: | 215 |
Species: | Rattus norvegicus |
Alignment Length: | 65 |
Identity: | 30/65 - (46%) |
Similarity: | 39/65 - (60%) |
Gaps: | 0/65 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 311 FTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKWRKHEPPRKTGYIKTST 375
||..||.|::..||...|||.|.|:|||..:|:.|.:|:.||.|:|||.||.:.....|.|.|.|
Rat 103 FTPGQLWEMQAVFEETQYPDAFRRKELAELMNVDEQKVKDWFNNKRAKLRKIQREILKGKIITPT 167
Fly 376 375
Rat 168 167
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR24329 |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.