DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and Alx4

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001100023.1 Gene:Alx4 / 296511 RGDID:1310201 Length:399 Species:Rattus norvegicus


Alignment Length:309 Identity:99/309 - (32%)
Similarity:137/309 - (44%) Gaps:63/309 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 PHHLDHLDHGS-----DGLLQDSSPVMINGGSAG--GKLKKPDEMCSQLEAG-GAGVTPPSSSST 249
            |.|| :|..|:     ||.|:      :..||.|  ..|:.|   |...|:. |....||.|.. 
  Rat   107 PAHL-YLQRGACKTPPDGSLK------LQEGSGGHNAALQVP---CYAKESNLGEPELPPDSEP- 160

  Fly   250 VVNGTTNGTGNANSSSSA-GVGIQGAAGTAGG-VAAPAAKKDGSSSKKKGDPNGIKKKKTRTTFT 312
                    .|..||..|. ..|.:|....||. :.:|..|.|..|||.       ||::.|||||
  Rat   161 --------VGMDNSYLSVKETGAKGPQDRAGAEIPSPLEKTDSESSKG-------KKRRNRTTFT 210

  Fly   313 AYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKWRKHEPPRKTGYIKTSTPP 377
            :|||||||:.|::..||||:|||:||::.:|:|:|||||||||||||||.|...:...::|....
  Rat   211 SYQLEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWRKRERFGQMQQVRTHFST 275

  Fly   378 TATLNPGTLAPPFTSYPQTTTVTPPGSMDSWTSYQTPYELTPQFSLLSPAASPYG---------- 432
            ...|...|.|..:......:.:...|:.....:...|.:..|  :.:||.|.|.|          
  Rat   276 AYELPLLTRAENYAQIQNPSWIGNNGAASPVPACVVPCDPVP--ACMSPHAHPPGSGASSVSDFL 338

  Fly   433 --TYSGQYGAYVHESQLF-------PMRHYEY-GSPTRMEMGATTGSVA 471
              :.:|.:....|...||       .:..||. |.|.|     .|.|:|
  Rat   339 SVSGAGSHVGQTHMGSLFGAAGISPGLNGYEMNGEPDR-----KTSSIA 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 31/46 (67%)
Alx4NP_001100023.1 Homeobox 206..258 CDD:278475 36/51 (71%)
OAR 375..392 CDD:281777 4/13 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.970

Return to query results.
Submit another query.