DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and sebox

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001306981.1 Gene:sebox / 282666 ZFINID:ZDB-GENE-021206-4 Length:293 Species:Danio rerio


Alignment Length:141 Identity:48/141 - (34%)
Similarity:65/141 - (46%) Gaps:26/141 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 KKGDPNGIKKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKW 359
            :.|...|.:|:| ||.|:..||.||||||...||||:..||.||....|.||::|||||||||:.
Zfish    50 RTGHVEGQRKRK-RTIFSRAQLSELERAFMITPYPDITLRERLAALTLLPESKIQVWFQNRRARS 113

  Fly   360 RKHE----PPRKTGYIKTSTPPTATLNPGTLAPPFTSYPQTTTVTPPGSMDSWTSYQTPYELTPQ 420
            .|.:    |..:....|..|.|             .::|.......|.:..|...:|.       
Zfish   114 MKSKKLITPVSRRSPAKDCTFP-------------ATHPDLNLEQSPEANKSLRHHQQ------- 158

  Fly   421 FSLLSPAASPY 431
             ||:..|.:|:
Zfish   159 -SLIRQALNPW 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 28/46 (61%)
seboxNP_001306981.1 COG5576 13..159 CDD:227863 44/130 (34%)
Homeobox 61..112 CDD:278475 31/51 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..144 5/39 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.