DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and PDLIM3

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_055291.2 Gene:PDLIM3 / 27295 HGNCID:20767 Length:364 Species:Homo sapiens


Alignment Length:276 Identity:54/276 - (19%)
Similarity:88/276 - (31%) Gaps:96/276 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 KLNL-SESRVQVWFQNRRAKWRKHE--------PPRKTGYIKTSTPPTATLNPGTLAPPFTSYPQ 395
            |:|| ||.:...:|::      ||.        |.|.:|   .|||.......|...|  :|...
Human   102 KINLESEPQDGNYFEH------KHNIRPKPFVIPGRSSG---CSTPSGIDCGSGRSTP--SSVST 155

  Fly   396 TTTVTP-------------------PGSMDSWTSYQTPYELTPQFSLLSPAASPYGTYSGQ---- 437
            .:|:.|                   ||.......:.||.:|....:::........|..|:    
Human   156 VSTICPGDLKVAAKLAPNIPLEMELPGVKIVHAQFNTPMQLYSDDNIMETLQGQVSTALGETPLM 220

  Fly   438 ---YGAYVHESQLFPMRHYEYGSPTRMEMGAT----TGSVAGNGDESVA------------NGGS 483
               ..:...||.::.|.|.....||:.....:    .|.|....|:..|            :|||
Human   221 SEPTASVPPESDVYRMLHDNRNEPTQPRQSGSFRVLQGMVDDGSDDRPAGTRSVRAPVTKVHGGS 285

  Fly   484 YQTAELQTAQQQQLAD--GTLVTVHAHQQQQQQQQQLNGKYLSAEEAKYVHLQCHQSGGGLELSP 546
                  ..||:..|.|  |:.:.               |..:.|.: ||.|.:|...        
Human   286 ------GGAQRMPLCDKCGSGIV---------------GAVVKARD-KYRHPECFVC-------- 320

  Fly   547 GASCHL-VEAQGQHYV 561
             |.|:| ::.:|..::
Human   321 -ADCNLNLKQKGYFFI 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 6/20 (30%)
PDLIM3NP_055291.2 PDZ_signaling 2..80 CDD:238492
DUF4749 184..263 CDD:374237 13/78 (17%)
LIM_ALP 294..346 CDD:188834 12/67 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.