DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and LHX6

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:XP_011516823.1 Gene:LHX6 / 26468 HGNCID:21735 Length:407 Species:Homo sapiens


Alignment Length:142 Identity:43/142 - (30%)
Similarity:66/142 - (46%) Gaps:15/142 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 IQGAAGTAGGVAAPAAKKDGSSSKKKGDPNGIKKKKTRTTFTAYQLEELERAFERAPYPDVFARE 335
            ::.||....|:....|......|:.|      ..|:.||:|||.||:.::..|.:...||....:
Human   221 LKRAAENGNGLTLEGAVPSEQDSQPK------PAKRARTSFTAEQLQVMQAQFAQDNNPDAQTLQ 279

  Fly   336 ELAIKLNLSESRVQVWFQNRRAKWRKHEPPRKTGYIKTSTPPTATLNPGTLA-----PPFTSYPQ 395
            :||....||...:||||||.||:.:||.|...   :..|..|.:.| |..|:     .||:|..:
Human   280 KLADMTGLSRRVIQVWFQNCRARHKKHTPQHP---VPPSGAPPSRL-PSALSDDIHYTPFSSPER 340

  Fly   396 TTTVTPPGSMDS 407
            ...||..|.:::
Human   341 ARMVTLHGYIET 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 18/46 (39%)
LHX6XP_011516823.1 LIM1_Lhx6 99..152 CDD:188766
LIM2_Lhx6 160..214 CDD:188768
Homeobox 252..304 CDD:278475 22/51 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.