DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and Gsc2

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_083745.2 Gene:Gsc2 / 195333 MGIID:892006 Length:201 Species:Mus musculus


Alignment Length:213 Identity:59/213 - (27%)
Similarity:87/213 - (40%) Gaps:38/213 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 PQQLQHLYGGSPHHLDHLDHGSDGLLQDSSPVMINGGSAGGKLKKPDEMCSQLEAGGAGV-TPPS 245
            |..::|:....|....        ..:...||   ||....:|.:|:          |.| ..|.
Mouse    18 PFSIEHILSSLPERRP--------ATRPPQPV---GGRNPAELDEPE----------APVPAAPC 61

  Fly   246 SSSTVVNGTTNGTGNANSSSSAGV----GIQGAAGTAGGVAAPAAKKDGSSSKKKGDPNGIKKKK 306
            :.....|......|...:||..|:    .::.|..|...:.||.|.....:......|.. :.::
Mouse    62 ACCCCCNPRAATRGTPETSSGPGLRLAWPLRLAPATPSPLTAPRAGSPALTGTSGPGPQR-RTRR 125

  Fly   307 TRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKWRKHEPPRKTGYI 371
            .||.|:..||:.||..|.:..||||..||.||:::.|.|.||:|||:||||||| |:        
Mouse   126 HRTIFSEEQLQALEALFVQNQYPDVGTRERLAVRIRLREERVEVWFKNRRAKWR-HQ-------- 181

  Fly   372 KTSTPPTATLNPGTLAPP 389
              ....::.|.|||...|
Mouse   182 --KRASSSRLLPGTKKTP 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 25/46 (54%)
Gsc2NP_083745.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53 8/45 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 96..123 5/27 (19%)
Homeobox 126..180 CDD:333795 30/54 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..201 7/30 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.