DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and Prop1

DIOPT Version :10

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_032962.1 Gene:Prop1 / 19127 MGIID:109330 Length:223 Species:Mus musculus


Alignment Length:155 Identity:60/155 - (38%)
Similarity:79/155 - (50%) Gaps:29/155 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 KKGDPNGIKKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKW 359
            ::|.|:  .:::.||||...|||:||.||.|..|||::|||.||....|||:|:||||||||||.
Mouse    59 QRGRPH--SRRRHRTTFNPAQLEQLESAFGRNQYPDIWAREGLAQDTGLSEARIQVWFQNRRAKQ 121

  Fly   360 RKHEPPRKTGYIKTSTPPTATLNPGTLA---PPFTSYPQTTTVTPP----------GSMDSWTSY 411
            ||.|        ::...|.|.|:..|.:   |..::||.|....||          .|:.|..|.
Mouse   122 RKQE--------RSLLQPIAHLSTATFSGFLPESSAYPYTYGTPPPPAPCFPHPYSHSLPSQPST 178

  Fly   412 QTPYELTPQ----FSLLSPAASPYG 432
            .....|.||    :..|.||  |.|
Mouse   179 AASLALPPQPEDWYPTLHPA--PTG 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeodomain 313..361 CDD:459649 30/47 (64%)
Prop1NP_032962.1 Homeodomain 67..123 CDD:459649 34/55 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 168..223 11/36 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 2/11 (18%)

Return to query results.
Submit another query.