DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and Pitx3

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:XP_006526827.1 Gene:Pitx3 / 18742 MGIID:1100498 Length:388 Species:Mus musculus


Alignment Length:230 Identity:73/230 - (31%)
Similarity:103/230 - (44%) Gaps:52/230 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 PPSSSSTVVNGTTNGTGNANSSSSAGV--------GIQG---------AAGTAGGVAAPAAKKDG 290
            |||....:: |.......|.|.|.||.        |.:|         :|...||     :.:||
Mouse    84 PPSMEFGLL-GEAEARSPALSLSDAGTPHPPLPEHGCKGQEHSDSEKASASLPGG-----SPEDG 142

  Fly   291 SSSKKKGDPNGIKKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNR 355
            |..|        |:::.||.||:.||:|||..|:|..|||:..|||:|:..||:|:||:|||:||
Mouse   143 SLKK--------KQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNR 199

  Fly   356 RAKWRKHEPPRKTGYIKTS--------TPPTATLNPG---------TLAPPFT--SYPQTTTVTP 401
            ||||||.|..::....|..        .||...:.||         .||||..  ::|.......
Mouse   200 RAKWRKRERSQQAELCKGGFAAPLGGLVPPYEEVYPGYSYGNWPPKALAPPLAAKTFPFAFNSVN 264

  Fly   402 PGSMDSWTSYQTPYELTPQFSLLSPAASPYGTYSG 436
            .|.:.|...:..|..:..  |::..||:..||..|
Mouse   265 VGPLASQPVFSPPSSIAA--SMVPSAAAAPGTVPG 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 27/46 (59%)
Pitx3XP_006526827.1 Homeobox 152..205 CDD:365835 32/52 (62%)
PTZ00395 <228..>322 CDD:185594 18/72 (25%)
OAR 344..361 CDD:367680
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.