DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and ceh-53

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_500361.3 Gene:ceh-53 / 182467 WormBaseID:WBGene00015651 Length:203 Species:Caenorhabditis elegans


Alignment Length:224 Identity:68/224 - (30%)
Similarity:95/224 - (42%) Gaps:65/224 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 KDGSSSKKKGDPNGIKK--KKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQV 350
            |:.|||..:...|..::  ::.||.|:..|||.||.||.:..||||..||.|..:..|:|:|:||
 Worm    13 KECSSSPPQSAQNSEERRVRRLRTAFSENQLELLEEAFLKCQYPDVQQRETLGKQTELAEARIQV 77

  Fly   351 WFQNRRAKWRKHEPPRKT----------------GYIK----------TSTPPTATLNPGTLAPP 389
            ||:|||||.||.:....|                |.:|          |.||..|..| .:|:|.
 Worm    78 WFKNRRAKARKRQRNESTDSCSTTEESNEEGDADGCLKKKAKNETTIITWTPGAALFN-SSLSPT 141

  Fly   390 FTSYPQTTTVTPPGSMDSWTSYQTPYELTPQFSLLSPAASPYGTYSGQYGAYVHESQLFPMRHYE 454
            .||.|  ||..||   .::..:|.|:.          |.:||...:                   
 Worm   142 TTSIP--TTPAPP---LNFICHQNPFY----------AYNPYRNLN------------------- 172

  Fly   455 YGSPTRMEMGATTGSVAGNGDESVANGGS 483
             ..||.:....||.:..|:. :.|||.||
 Worm   173 -TIPTHLLAATTTAASIGSA-KLVANVGS 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 26/46 (57%)
ceh-53NP_500361.3 Homeobox 35..81 CDD:365835 24/45 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.