DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and npax-4

DIOPT Version :10

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001255346.1 Gene:npax-4 / 182466 WormBaseID:WBGene00007496 Length:202 Species:Caenorhabditis elegans


Alignment Length:54 Identity:18/54 - (33%)
Similarity:27/54 - (50%) Gaps:17/54 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 AAKKDGSSSKKKGDPNGIKKKKTRTTFTAYQLEELERAFERAPYPDVFAREELA 338
            ||:|    :...|.|:|       ::..|  ||:|.:||.|   ||:.. |:||
 Worm    24 AAQK----ALSNGHPSG-------SSLAA--LEKLSKAFRR---PDLHI-EKLA 60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeodomain 313..361 CDD:459649 12/26 (46%)
npax-4NP_001255346.1 HTH_ARSR 79..>142 CDD:481197
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.