DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and ceh-51

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_507685.1 Gene:ceh-51 / 180233 WormBaseID:WBGene00013583 Length:234 Species:Caenorhabditis elegans


Alignment Length:357 Identity:66/357 - (18%)
Similarity:94/357 - (26%) Gaps:170/357 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GGPLNPLGAKPLMPTTTAMHPVMLGSVHELCSQQQQQQQQQRLPDCNTILPNGGGGGAGSGGAGG 80
            ||...||.:..|..|:...:..::              :...:|            .:..|....
 Worm    11 GGDYYPLSSSNLNSTSAITNATVM--------------EYSTMP------------SSSPGSMSS 49

  Fly    81 SPNYVTKLDFVNKMGCYSPSQKYEYISAPQKLVEQQQQQQHHHQHHQHYTATPPPSHNG----IL 141
            ||.|.....        :||..  |::.|.:|..|||.                 :|||    :.
 Worm    50 SPAYPAAYQ--------APSPC--YVADPNQLYYQQQL-----------------AHNGNDMLVQ 87

  Fly   142 LHKQSSQQQ-----QQQQQQLVGILDYHPLNGKLDYSSSPKDQYEPQQLQHLYGGSPHHLDHLDH 201
            .|.|:.|.|     |||..||                 ||.....|....|              
 Worm    88 AHAQAYQAQCFAWFQQQYSQL-----------------SPSSFPHPMVAHH-------------- 121

  Fly   202 GSDGLLQDSSPVMINGGSAGGKLKKPDEMCSQLEAGGAGVTPPSSSSTVVNGTTNGTGNANSSSS 266
                                                 ||..||..|........:          
 Worm   122 -------------------------------------AGFIPPPPSFLHHQHQQH---------- 139

  Fly   267 AGVGIQGAAGTAGGVAAPAAKKDGSSSKKKGDPNGIKKKKTRTTFTAYQLEELERAFERAPYPDV 331
                          ..||:.|:.|:                ||.|:..||..|...||:.....|
 Worm   140 --------------PRAPSEKRRGA----------------RTPFSDSQLYALRTRFEQCDTIKV 174

  Fly   332 FAREELAIKLNLSESRVQVWFQNRRAKWRKHE 363
            ..|.:|...:.||..::::||||||.|.||.:
 Worm   175 DERRKLGAVIGLSPEQIKIWFQNRRFKLRKEK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 17/46 (37%)
ceh-51NP_507685.1 Homeobox 151..204 CDD:365835 20/52 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.