DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and ceh-17

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_491393.1 Gene:ceh-17 / 172059 WormBaseID:WBGene00000440 Length:237 Species:Caenorhabditis elegans


Alignment Length:271 Identity:79/271 - (29%)
Similarity:109/271 - (40%) Gaps:82/271 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 QHHHQHHQHYTATPPPSHNGILL---HKQSSQQQQQQQQQLVGILDYHPLNGKLDYSSSPKDQYE 181
            |.|:.:||:.|   |...:|..|   |..||...                 |....|||....|.
 Worm    38 QSHNIYHQYAT---PYLQSGRALTTAHNTSSSSA-----------------GNSTSSSSSSSNYR 82

  Fly   182 PQQLQHLYGGSPHHLDHLDHGSDGLLQDSSPVMINGGSAGGKLKKPDEMCSQLEAGGAGVTPPSS 246
                     .:.|              ||.....|.|......:|     |||....   |...:
 Worm    83 ---------NTTH--------------DSLQAFFNTGLQYQLYQK-----SQLIGSD---TIQRT 116

  Fly   247 SSTVVNGTTNGTGNANSSSSAGVGIQGAAGTAGGVAAPAAKKDGSSSKKKGDPNGIKKKKTRTTF 311
            ||.|:||...       ||..|    ....|.|....||.::              |:::.||||
 Worm   117 SSNVLNGLPR-------SSLVG----ALCSTGGAPLNPAERR--------------KQRRIRTTF 156

  Fly   312 TAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKWRKHEPPRKTGYIKTSTP 376
            |:.||:||||:|....|||::.|||:|::::|:|:||||||||||||:||.|..|:   :|....
 Worm   157 TSGQLKELERSFCETHYPDIYTREEIAMRIDLTEARVQVWFQNRRAKYRKQEKIRR---VKDEEE 218

  Fly   377 PTATLNPGTLA 387
            ......||.::
 Worm   219 DPLKKEPGQIS 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 28/46 (61%)
ceh-17NP_491393.1 DLL_N 20..112 CDD:403572 25/124 (20%)
Homeobox 153..206 CDD:395001 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.