DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and Lhx2

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:XP_006497796.1 Gene:Lhx2 / 16870 MGIID:96785 Length:414 Species:Mus musculus


Alignment Length:411 Identity:102/411 - (24%)
Similarity:147/411 - (35%) Gaps:113/411 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 DCNTILPN-GGGGGAGSGGAGG--SPNYV-----------------TKLDFVNKMGCYSPSQ--- 101
            |..|.:|: .....|...|.||  |..|.                 .||:..:::.|:|...   
Mouse    37 DTETTMPSISSDRAALCAGCGGKISDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIY 101

  Fly   102 -KYEYISAPQKLVEQQQQQQHHHQHHQHYTATPPPSHNGILLHKQSSQQQQQQQQQLVGILDYHP 165
             |.:|.|           ...|..|.:.........|.||     |:.:...:.:.||    || 
Mouse   102 CKEDYYS-----------PSLHGPHRRFSVQRCARCHLGI-----SASEMVMRARDLV----YH- 145

  Fly   166 LN-------GKL----DYSSSPKDQYEPQQLQH---LYGGSPHHLDHLDHGSDGLLQDSSPVMIN 216
            ||       .|:    |:... ||.....:|..   |.|..|.|.:|.|      :..::.....
Mouse   146 LNCFTCTTCNKMLTTGDHFGM-KDSLVYCRLHFEALLQGEYPAHFNHAD------VAAAAAAAAA 203

  Fly   217 GGSAGGKLKKPDEMCSQLEAGGAGVTPPSSSSTVVNGTTNGT---GNANSSSSAGVGIQGAAGTA 278
            ..|||              .|.||..|  ......||.  ||   |......|.|.|...||..|
Mouse   204 AKSAG--------------LGSAGANP--LGLPYYNGV--GTVQKGRPRKRKSPGPGADLAAYNA 250

  Fly   279 GGVAAPAAKKDGSS-SKKKGDPNGIKKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLN 342
               |....:.|... .:.:..|:..|.|:.||:|..:||..::..|.....||....::||.|..
Mouse   251 ---ALSCNENDAEHLDRDQPYPSSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTG 312

  Fly   343 LSESRVQVWFQNRRAKWRKH-EPPRKTGYIKTS-------TP--PTATLNPGTLAPPFT------ 391
            |::..:||||||.|||:|:: .....||..|||       ||  |.:.|:..:|:|..|      
Mouse   313 LTKRVLQVWFQNARAKFRRNLLRQENTGVDKTSDATLQTGTPSGPASELSNASLSPSSTPTTLTD 377

  Fly   392 -SYPQTTTVTP-----PGSMD 406
             :.|...|||.     ||:::
Mouse   378 LTSPTLPTVTSVLTSVPGNLE 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 18/46 (39%)
Lhx2XP_006497796.1 LIM1_Lhx2 43..106 CDD:188853 12/62 (19%)
LIM2_Lhx2_Lhx9 119..177 CDD:188763 15/68 (22%)
COG5576 <255..386 CDD:227863 39/130 (30%)
Homeobox 278..331 CDD:395001 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.