DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and RHOXF1

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:XP_011529583.1 Gene:RHOXF1 / 158800 HGNCID:29993 Length:212 Species:Homo sapiens


Alignment Length:133 Identity:41/133 - (30%)
Similarity:62/133 - (46%) Gaps:16/133 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 SSSSTVVNGTTNGTGNANSSSSAGVGIQGAAGTAGGV--------------AAPAAKKDGSSSKK 295
            |:...|..|.....||.|  ...||..:......||:              ..|..::...::.:
Human    60 SAEGHVGQGAPGLMGNMN--PEGGVNHENGMNRDGGMIPEGGGGNQEPRQQPQPPPEEPAQAAME 122

  Fly   296 KGDPNGIKKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKWR 360
            ...|..::.:..||.||..|:||||..|....||||..|.|||..|.::|.:|:|||:|:||:.|
Human   123 GPQPENMQPRTRRTKFTLLQVEELESVFRHTQYPDVPTRRELAENLGVTEDKVRVWFKNKRARCR 187

  Fly   361 KHE 363
            :|:
Human   188 RHQ 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 23/46 (50%)
RHOXF1XP_011529583.1 homeodomain 132..190 CDD:238039 28/57 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.