DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and GSC

DIOPT Version :10

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_776248.1 Gene:GSC / 145258 HGNCID:4612 Length:257 Species:Homo sapiens


Alignment Length:61 Identity:33/61 - (54%)
Similarity:45/61 - (73%) Gaps:0/61 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 KKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKWRKHE 363
            :|::.||.||..|||.||..|:...||||..||:||.|::|.|.:|:|||:|||||||:.:
Human   159 RKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeodomain 313..361 CDD:459649 27/47 (57%)
GSCNP_776248.1 Homeodomain 161..217 CDD:459649 31/55 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..257 4/7 (57%)

Return to query results.
Submit another query.