DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and dmbx1a

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_694509.1 Gene:dmbx1a / 142987 ZFINID:ZDB-GENE-020117-1 Length:388 Species:Danio rerio


Alignment Length:334 Identity:81/334 - (24%)
Similarity:115/334 - (34%) Gaps:106/334 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 KKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKWRK------ 361
            |::::||.|||.|||.||:.|::..||||..||.||:..||.|:||||||:|||||:||      
Zfish    70 KQRRSRTAFTAQQLEALEKTFQKTHYPDVVMRERLAMCTNLPEARVQVWFKNRRAKFRKKQRSLQ 134

  Fly   362 -------------------------------HEPPRKTGYIKTSTPPTATLNPGTLAPPFTSYPQ 395
                                           ::||..|   .:|:...|...|..|....:....
Zfish   135 KEQLQKQKDVSTDGALAASDKDEAPSTLNLENQPPSST---SSSSSMEAEAAPHALGSELSVELN 196

  Fly   396 TTTVTPPGSMDSWTSYQT--------------------PYELTPQFSLLSPAA-SPYG------T 433
            .|:....||..:.....|                    |..|:|....|||.. ||.|      :
Zfish   197 VTSAEQSGSESATEDNATDKEEEIKQHREDLKVEKEPAPGNLSPLCKRLSPKPDSPLGSPAISSS 261

  Fly   434 YSGQYG--AYVHESQLFPMRHYEYGSPTRMEMGATTGSVAGNGDESVANGGSYQTAELQTAQ--- 493
            .||..|  :..|.....|:..:......|..|.||...|            .|.:.::.|..   
Zfish   262 SSGVTGGISQSHSYSSSPLSLFRLQEQFRQHMAATNNLV------------HYPSFDMATPSSIP 314

  Fly   494 ------QQQLADGTLVTVHAHQQQQQQQQQL---------------NGKYLSAEEAKYVHLQCHQ 537
                  ......|:|.....:|......||:               |.|..|.|..: :..:.|.
Zfish   315 YLGMNVNMPAPLGSLPCQSYYQSLSHHAQQVWNSPLLQASGGLPSHNSKTTSIENLR-LRAKQHA 378

  Fly   538 SGGGLELSP 546
            :..||:..|
Zfish   379 ASLGLDTLP 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 29/46 (63%)
dmbx1aNP_694509.1 Homeobox 74..127 CDD:278475 33/52 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..272 23/145 (16%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 365..378 2/13 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.