DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and DMBX1

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001374705.1 Gene:DMBX1 / 127343 HGNCID:19026 Length:382 Species:Homo sapiens


Alignment Length:312 Identity:82/312 - (26%)
Similarity:119/312 - (38%) Gaps:89/312 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 KKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKWRKH----- 362
            |::::||.|||.|||.||:.|::..||||..||.||:..||.|:||||||:|||||:||.     
Human    70 KQRRSRTAFTAQQLEALEKTFQKTHYPDVVMRERLAMCTNLPEARVQVWFKNRRAKFRKKQRSLQ 134

  Fly   363 -------------------EPPRKTGYIKTSTPPTATLNPGTLAPPFTSYPQTTTVTPPGSMDSW 408
                               |.|.....:.|..||..   ||: .||...:   .:::...:.:|.
Human   135 KEQLQKQKEAEGSHGEGKAEAPTPDTQLDTEQPPRL---PGS-DPPAELH---LSLSEQSASESA 192

  Fly   409 TSYQTPYELTPQFSLLSPAA--SPYGTYSGQYGAYVHESQLFPMRHYEYGSPTRMEMGATTGSVA 471
            ...|...|..|:.....|.|  || |..|...|.             :.|||.....|:.|.:..
Human   193 PEDQPDREEDPRAGAEDPKAEKSP-GADSKGLGC-------------KRGSPKADSPGSLTITPV 243

  Fly   472 GNGDESVANGGSYQTAELQTAQQQQLADGTLVTVHAHQQQQQQQQQLNGKYLSAEEAKYVHLQCH 536
            ..|...:....||.::.|.                ..:.|:|.:|.:      |.....||....
Human   244 APGGGLLGPSHSYSSSPLS----------------LFRLQEQFRQHM------AATNNLVHYSSF 286

  Fly   537 QSGG---------------GLELSPGASCHLVEAQGQHYVTTATGGAASAGG 573
            :.||               |:.::|..|.|.     |.|..:.:..||:..|
Human   287 EVGGPAPAAAAAAAAVPYLGVNMAPLGSLHC-----QSYYQSLSAAAAAHQG 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 29/46 (63%)
DMBX1NP_001374705.1 Interaction with OTX2 and is required for repressor activity. /evidence=ECO:0000250|UniProtKB:Q91ZK4 1..156 37/85 (44%)
Homeobox 74..128 CDD:395001 33/53 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..252 27/144 (19%)
OAR 357..373 CDD:397759
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 359..372
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.