DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and Vsx2

DIOPT Version :10

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001288356.1 Gene:Vsx2 / 12677 MGIID:88401 Length:380 Species:Mus musculus


Alignment Length:205 Identity:76/205 - (37%)
Similarity:94/205 - (45%) Gaps:59/205 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 GSAGGKLKKP-DEMCSQLEAGGA-------GV--------TPPSS-SSTVVNGTTNGTGNANSS- 264
            |.||..|.|| .|..::..:|||       |:        .|||| ....::|...|...|..| 
Mouse     3 GKAGEALSKPKSETVAKSTSGGAPARCTGFGIQEILGLNKEPPSSHPRAALDGLAPGHLLAARSV 67

  Fly   265 -SSAGVGIQGAAGTAG----------------------------------GVAAPAAKKDGSSSK 294
             |.||||..|..|..|                                  ...|.:..:|.|||.
Mouse    68 LSPAGVGSMGLLGPGGLPGFYTQPTFLEVLSDPQSVHLQPLGRASGPLDTSQTASSDSEDVSSSD 132

  Fly   295 KKGDPNGI------KKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQ 353
            :|...:.:      ||::.||.||:|||||||:||..|.||||:|||.||:|..|.|.|:|||||
Mouse   133 RKMSKSALNQTKKRKKRRHRTIFTSYQLEELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQ 197

  Fly   354 NRRAKWRKHE 363
            ||||||||.|
Mouse   198 NRRAKWRKRE 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeodomain 313..361 CDD:459649 34/47 (72%)
Vsx2NP_001288356.1 Homeodomain 153..205 CDD:459649 37/51 (73%)
OAR 319..337 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.