DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and Alx3

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_031467.1 Gene:Alx3 / 11694 MGIID:1277097 Length:343 Species:Mus musculus


Alignment Length:289 Identity:84/289 - (29%)
Similarity:127/289 - (43%) Gaps:49/289 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 SPKDQYEPQQLQHLYGGSPH---------------HLDHLDHGSDGLLQDSSP-VMINGGSAGGK 223
            :|..|..|....||:...|.               :|..........|||..| .::|||.....
Mouse    25 APGPQGTPDAAPHLHPAPPRGPRLSRFPACGPLEPYLPEPAKPPAKYLQDLGPGPVLNGGHFYEG 89

  Fly   224 LKKPDEMCSQLEAGGAGVTPPSSSSTVVNGTTNGTGNANSSSS---AGVGIQGAAGTAGGVAAPA 285
            ..:.:|..|:      ..:.|........|..:|..|..:|..   |.:.:..:.|....:....
Mouse    90 SAEAEEKASK------AASFPQLPVDCRGGPRDGPSNVQASPGPCLASLSVPLSPGLPDSMELAK 148

  Fly   286 AKKDGSSSKKKGDPNGIKKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQV 350
            .|.              ||::.||||:.:||||||:.|::..||||:|||:||::.:|:|:||||
Mouse   149 TKS--------------KKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQV 199

  Fly   351 WFQNRRAKWRKHEPPRKTGYIKTSTPPTATLNPGTLAPPFTSYPQ-TTTVTP-PGSMDSWTSYQT 413
            |||||||||||.|   :.|.::....|..|....::.|...|:|| ..::.| |||    .|...
Mouse   200 WFQNRRAKWRKRE---RYGKMQEGRNPFTTAYDISVLPRTDSHPQLQNSLWPSPGS----GSPGG 257

  Fly   414 PYELTPQFSLLSPAASPYGTYSGQYGAYV 442
            |..::|: .:.||..|||....|....::
Mouse   258 PCLMSPE-GIPSPCMSPYSHSHGNVAGFM 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 30/46 (65%)
Alx3NP_031467.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..122 20/102 (20%)
SP2 32..>141 CDD:281067 21/114 (18%)
Homeobox 157..209 CDD:278475 34/51 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.970

Return to query results.
Submit another query.