DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and Phox2a

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_446321.2 Gene:Phox2a / 116648 RGDID:621323 Length:281 Species:Rattus norvegicus


Alignment Length:280 Identity:85/280 - (30%)
Similarity:110/280 - (39%) Gaps:96/280 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 SAGVGIQGAAGTAGG-----------VAAPAAKKDGSSSKKKG-------------------DPN 300
            ::..|..||....||           .|.|.....|||:...|                   :|:
  Rat    18 ASAYGDFGACSQPGGFQYSPLRPAFPAAGPPCPALGSSNCALGALRDHQPAPYSAVPYKFFPEPS 82

  Fly   301 GI----KKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKWRK 361
            |:    |:::.|||||:.||:||||.|....|||::.|||||:|::|:|:||||||||||||:||
  Rat    83 GLHEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRK 147

  Fly   362 HE-----------PPRKTGYIKTSTPPTATLNPGTLAPPFTSYPQTTTVTPPGSMDSWTSYQTPY 415
            .|           ...|.|..:.|:...            .|...|.:.||    ||..|...| 
  Rat   148 QERAASAKGAAGATGAKKGEARCSSEDD------------DSKESTCSPTP----DSTASLPPP- 195

  Fly   416 ELTPQFSLLSPAASP------YGTYSGQYGAYVHESQLFPMRHYEYGSPTRMEMGATTGSVAGNG 474
              .|..||.||..||      .|:..|..          |::            ||....|||.|
  Rat   196 --PPAPSLASPRLSPSPLPAALGSGPGPQ----------PLK------------GALWAGVAGGG 236

  Fly   475 DESVANGGSYQTAELQTAQQ 494
                ..|.....|||..|.|
  Rat   237 ----GGGPGAGAAELLKAWQ 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 30/46 (65%)
Phox2aNP_446321.2 Homeobox 94..147 CDD:395001 35/52 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..219 22/92 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.