DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and alx4

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:XP_004913406.1 Gene:alx4 / 100493396 XenbaseID:XB-GENE-853003 Length:376 Species:Xenopus tropicalis


Alignment Length:311 Identity:93/311 - (29%)
Similarity:128/311 - (41%) Gaps:69/311 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 HHLDHLDHGSDGLLQDSSPVMINGGSAGGKLKKPDEMCSQLEAGGAGVTP--PSSSSTVVNGTTN 256
            ||..|....|. |...|:|           .|.|.:.....::.|..:.|  ...|:...|....
 Frog    90 HHPSHQQQQSH-LYMQSTP-----------CKSPSDSLKVQDSPGDPLIPCYAKESALTPNSDHQ 142

  Fly   257 G--TGNANSSSSAGVGIQGAAGTAGGVAAPAAKKDGSSSKKKGDPNGIKKKKTRTTFTAYQLEEL 319
            |  :|...|..:||.|.|    ..|....|..|.:..|:|.       ||::.|||||:||||||
 Frog   143 GMDSGYITSKETAGKGSQ----DRGSGDLPMDKTESESNKG-------KKRRNRTTFTSYQLEEL 196

  Fly   320 ERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKWRKHEPPRKTGYIKTSTPPTATL--- 381
            |:.|::..||||:|||:||::.:|:|:|||||||||||||||.|...:...::|.......|   
 Frog   197 EKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWRKRERFGQMQQVRTHFSSAYELPLL 261

  Fly   382 ----------NPGTLAPPFTSYPQTTTVTPPGSMDSWTSYQTPYELTPQFSLLSPAASPYGTYSG 436
                      ||..:.......|....|.|   .|:.:|..:|:........:|...|..|.   
 Frog   262 TRAENYAQIQNPSWIGNNGGGSPVPACVVP---CDTVSSCMSPHSHPHSAGGVSEFLSVPGP--- 320

  Fly   437 QYGAYVHESQLFPMRHYEYGSPTRMEMGATTGSVA-GNGDESVANGGSYQT 486
              ||:|.::                .||...||.| |.|    .||....|
 Frog   321 --GAHVGQT----------------HMGGLFGSAAMGPG----INGYDLNT 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 31/46 (67%)
alx4XP_004913406.1 COG5576 120..266 CDD:227863 60/156 (38%)
Homeobox 185..238 CDD:365835 37/52 (71%)
OAR 352..370 CDD:367680
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.