DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and arxb

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:XP_002667096.1 Gene:arxb / 100329907 ZFINID:ZDB-GENE-121109-2 Length:385 Species:Danio rerio


Alignment Length:386 Identity:114/386 - (29%)
Similarity:162/386 - (41%) Gaps:90/386 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 SSQQQQQQQQQ------LVGILDYHPLNGKLDYSSSPKDQYEPQQLQHLYGGSPH-HLDHLDHGS 203
            ||:.::...:|      ...:|..:.::..|...|..|.|..|..|..|:   || ||.......
Zfish     2 SSEVEEDNPEQTNCRCKTPTLLSSYCIDSILGRKSPLKVQETPHSLWPLH---PHMHLPPKLRRP 63

  Fly   204 DGLLQDSS------PVMINGGSAGGKLKKPDEMCSQLEAGGAGVTPPSSSSTVVN--------GT 254
            ...|.|||      |.::.  :|..|||..:.....:...|:.....|..:|.:|        |.
Zfish    64 FAPLTDSSTDETAGPRLLQ--TACEKLKITEASIVNISRAGSYQEHASCKNTPINEEEGADICGE 126

  Fly   255 TNGT----------GNANSSSSAGVGIQGAAGTAGGVAAPAAKKDGSSSKKKGDPNGIKKKKTRT 309
            ||.|          .:..:|.|||                :..:||...:        |:::.||
Zfish   127 TNVTLKQEREAFLKNSEETSLSAG----------------SDTEDGMLKR--------KQRRYRT 167

  Fly   310 TFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKWRKHE----PPRKTGY 370
            |||:||||||||||::..|||||.|||||::|:|:|:|||||||||||||||.|    .|.....
Zfish   168 TFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKVGVQPHTLSL 232

  Fly   371 IKTSTPPTA-TLNPGTLAPPFTSYPQTTTVTPPGSMDSWTSYQTPYELTPQFSLLSPA---ASPY 431
            ..:..||.| :|.......||...|.      |....:|.:   |::     .|..||   .||.
Zfish   233 HYSGAPPAAQSLCHYLSGNPFVPNPH------PAIDSAWPA---PFQ-----RLAQPAQNSVSPP 283

  Fly   432 GTYSGQYGAYVHESQLFPMRHYEYGSPTRMEMGATTGSVAGNGDESVANGGSYQTAELQTA 492
            | :|...||.:       .||..:.:||...:..:.|.:|.......|..|..|.:.|.|:
Zfish   284 G-FSALLGAAM-------FRHPAFFNPTFGRLFTSLGPMALQRIPLPAIEGPIQRSHLTTS 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 35/46 (76%)
arxbXP_002667096.1 Homeobox 166..218 CDD:278475 40/51 (78%)
OAR 351..368 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.