DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and DUX4

DIOPT Version :10

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001280727.1 Gene:DUX4 / 100288687 HGNCID:50800 Length:424 Species:Homo sapiens


Alignment Length:175 Identity:54/175 - (30%)
Similarity:77/175 - (44%) Gaps:35/175 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 KKGDPNGIKKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKW 359
            ::|.|.|.:|   ||..|..|...|.||||:..:|.:.||||||.:..|.|||:|:|||||||  
Human    88 RRGPPEGRRK---RTAVTGSQTALLLRAFEKDRFPGIAAREELARETGLPESRIQIWFQNRRA-- 147

  Fly   360 RKH-----EPPRKTGYIKTSTPPTATLNPGTLAPPFTSYPQTTTVTPPGSMDSW-TSYQTPYELT 418
             :|     ..|.:.|.:.::.|     ..|..||.:.::..|         .:| |....|:  .
Human   148 -RHPGQGGRAPAQAGGLCSAAP-----GGGHPAPSWVAFAHT---------GAWGTGLPAPH--V 195

  Fly   419 PQFSLLSPAASPYGTYSGQ---YGAYVHESQLFPMRHYEYGSPTR 460
            |    .:|.|.|.|.:..|   ....:..||..|.......:|.|
Human   196 P----CAPGALPQGAFVSQAARAAPALQPSQAAPAEGISQPAPAR 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeodomain 313..361 CDD:459649 25/47 (53%)
DUX4NP_001280727.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
homeodomain 25..78 CDD:238039
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..102 6/16 (38%)
Homeodomain 95..149 CDD:459649 29/59 (49%)
PRK07764 <141..319 CDD:236090 29/119 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..362 5/19 (26%)
Required for interaction with EP300 and CREBBP, and for transcriptional activation of target genes. /evidence=ECO:0000269|PubMed:26951377 327..424
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 388..414
Important for transcriptional activation of target genes. /evidence=ECO:0000269|PubMed:29618456 405..424
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.