DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and shox2

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001093694.1 Gene:shox2 / 100101703 XenbaseID:XB-GENE-480993 Length:311 Species:Xenopus tropicalis


Alignment Length:323 Identity:89/323 - (27%)
Similarity:126/323 - (39%) Gaps:77/323 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 KLKKPDEMCSQ---LEAGGAGVTPPSSSSTVVNGTTNGT---GNANSSSSAGVGIQGAAGTAGGV 281
            |:|:..||.:.   ||:|.|....|        |...|.   |.|.:....|.|  |..|..||.
 Frog    15 KIKEKKEMITYREVLESGPARGKEP--------GCGEGAREDGLAGNRCIGGGG--GGGGGGGGA 69

  Fly   282 AAPAAKKDGSSS--KKKGDP--------------------------NGIKKKKTRTTFTAYQLEE 318
            .:|..:.|.|..  ::.|.|                          ..||::::||.||..||.|
 Frog    70 RSPVLELDLSVERIRESGSPKLTEVSPEIKERKEELKQQALEEEGQTKIKQRRSRTNFTLEQLNE 134

  Fly   319 LERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKWRKHEPPRKTGYIKTSTPPTATLNP 383
            |||.|:...|||.|.||||:.:|.|||:||||||||||||.||.|.....|.:         :..
 Frog   135 LERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHKGVL---------IGA 190

  Fly   384 GT------LAPPFTSYPQTTTVTPPGSMDSWTSYQT-PYELTPQFSLLSPAA------SPYGTYS 435
            |:      :||    |.....:..|...||..:..: .:::..|..|.|..|      .|:.|..
 Frog   191 GSQFEACRVAP----YVNVGALRMPFQQDSHCNVPSLSFQVQAQLQLDSAVAHAHHHLHPHLTAH 251

  Fly   436 GQYGAYVHESQLFPMRHYEYGSPTRMEMGATTGSVAGNGDESVANGGSYQTAELQTAQQQQLA 498
            ..|       .:||...:.....|.....||..||......:..:..:...|:|:...::..|
 Frog   252 APY-------MMFPAPPFGLPLATLAAETATAASVVAAAAAAKTSSKNSSIADLRLKAKKHAA 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 31/46 (67%)
shox2NP_001093694.1 Homeobox 123..177 CDD:365835 35/53 (66%)
OAR 292..307 CDD:367680 2/14 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.