DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and rax

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:XP_002936715.1 Gene:rax / 100038124 XenbaseID:XB-GENE-492665 Length:326 Species:Xenopus tropicalis


Alignment Length:263 Identity:87/263 - (33%)
Similarity:122/263 - (46%) Gaps:47/263 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 GGSPHHLDHLDHGSDGLLQDSSPVMINGG----SAGGKLKKPDEMCSQ--LEAGGAGVTPPSSSS 248
            ||:|..|    |..:.:|..|....:.|.    .:....|:.|:..|:  |......:.|  ...
 Frog    25 GGNPSRL----HSIEAILGFSKEDSVLGSFQTEVSPRNAKEVDKRSSRHCLHKMTEEIHP--QQE 83

  Fly   249 TVVNGTTNGTGNANSSSSAGVGIQGAAGTAGGVAAPAAKKDGSSSKKKGDPNGIKKKK---TRTT 310
            .:.:|.::|.|:..|..           |:....:|......:|..|..|.....|||   .|||
 Frog    84 HLEDGQSDGYGDPYSGK-----------TSSECLSPGLSTSNNSDNKLSDDEQQPKKKHRRNRTT 137

  Fly   311 FTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKWRKHEPPRKTGYIKTST 375
            ||.|||.|||||||::.||||::|||||:|:||.|.||||||||||||||:.|....|. :|...
 Frog   138 FTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKLEVTS-MKLQD 201

  Fly   376 PPTATLN----PGTLAPPFTSYPQTTTVTPPGSMDSW----TSYQTPYELTPQFSLLSPAASPYG 432
            .|..:.|    |..::...:|.|          :|||    .|..|..:..|.| :.||.:.| |
 Frog   202 SPILSFNRSPQPSAMSAISSSLP----------LDSWLTPSISNSTALQSLPGF-VTSPPSLP-G 254

  Fly   433 TYS 435
            :|:
 Frog   255 SYT 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 35/46 (76%)
raxXP_002936715.1 Homeobox 135..188 CDD:365835 41/52 (79%)
OAR 299..315 CDD:367680
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.