DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment repo and alx4a

DIOPT Version :9

Sequence 1:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster
Sequence 2:XP_001340966.1 Gene:alx4a / 100006399 ZFINID:ZDB-GENE-070712-3 Length:368 Species:Danio rerio


Alignment Length:320 Identity:103/320 - (32%)
Similarity:138/320 - (43%) Gaps:93/320 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 SPVMI--NGGSAGGKLKKP-DEMCSQLEA-GGAGV--------------TPPSSSS-TVVNGTTN 256
            ||..:  .|...|.|...| .:.|..|:| .|.|.              |||.||. ...|...|
Zfish    45 SPAFLTNKGQGYGEKSGSPFQQECQSLDATAGEGTFNKYHLFMQRSSCKTPPDSSKLQQENSGHN 109

  Fly   257 G----------TGNANS-----SSSAGV----------GIQGAAGTAGGVAAPAAKKDGSSSKKK 296
            |          ||..:|     |..||:          |::........:|:|..|.:|.|:|. 
Zfish   110 GGLIACYGKDSTGLTDSELPQNSDPAGMDGSYLSVKDSGVKSPQQATSELASPLDKTEGESNKG- 173

  Fly   297 GDPNGIKKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKWRK 361
                  ||::.|||||:|||||||:.|::..||||:|||:||::.:|:|:|||||||||||||||
Zfish   174 ------KKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRK 232

  Fly   362 HEPPRKTGYIKT--STP---PTAT--------LNPGTLAPPFTSYPQTTTVTPPGSMDSWTSYQT 413
            .|...:...::|  ||.   |..|        .||..:.....:.|....|.|   .||.||...
Zfish   233 RERFGQMQQVRTHFSTAYELPLLTRPENYAQIQNPSWIGGSSAASPVPGCVVP---CDSVTSCMP 294

  Fly   414 PYE-----LTPQFSLLSPAASPYGTYSGQYGAYVHESQLFPMRHYEYGSPTRMEMGATTG 468
            |:.     ::....:.||     |::.||    .|...||       |||     |..||
Zfish   295 PHPHAASGVSDFLGVPSP-----GSHMGQ----THMGSLF-------GSP-----GMGTG 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
repoNP_477026.1 Homeobox 313..360 CDD:278475 31/46 (67%)
alx4aXP_001340966.1 Homeobox 179..231 CDD:278475 36/51 (71%)
OAR 344..361 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.