DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SrpRbeta and Tsf1

DIOPT Version :9

Sequence 1:NP_001261596.1 Gene:SrpRbeta / 47283 FlyBaseID:FBgn0011509 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001285404.1 Gene:Tsf1 / 32821 FlyBaseID:FBgn0022355 Length:641 Species:Drosophila melanogaster


Alignment Length:165 Identity:37/165 - (22%)
Similarity:65/165 - (39%) Gaps:44/165 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 ASARLVDIPGHYRVRDKCLELYKHRAKGIVFVVDS----VTAHKDIRDVADFLYTILSDSATQPC 152
            |..|:..:.|..||  .||||.:.| |..|...:.    :..|:...|     |.::|:..||  
  Fly    56 AGIRMECVAGRDRV--DCLELIEQR-KADVLATEPEDMYIAYHRKNED-----YRVISEIRTQ-- 110

  Fly   153 SVLVLCNKQDQTTA-KSAQVIKSLLESELHTVRDTRSRKLQSVGDEDGSKSITLGKPGRDFEF-- 214
                    ||:..| :...:|....:|.:.|::..|           |:||...|. ||:..:  
  Fly   111 --------QDKDAAFRYEGIILVKKDSPIRTLQQLR-----------GAKSCHTGF-GRNVGYKI 155

  Fly   215 -------SHIAQNIQFAEASAKDTELDPLTDWLAR 242
                   :|:.:.....:.||.:.||..|:::..:
  Fly   156 PITKLKNTHVLKVSADPQISATERELKSLSEFFTQ 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrpRbetaNP_001261596.1 SR_beta 49..243 CDD:206691 37/165 (22%)
SRPRB 51..221 CDD:255367 32/142 (23%)
Tsf1NP_001285404.1 PBP2_transferrin 34..>302 CDD:270247 37/165 (22%)
Periplasmic_Binding_Protein_Type_2 384..615 CDD:304360
TR_FER 384..614 CDD:214514
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11485
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.