DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)05822 and BEM1

DIOPT Version :9

Sequence 1:NP_001262702.1 Gene:l(3)05822 / 47260 FlyBaseID:FBgn0010877 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_009759.3 Gene:BEM1 / 852499 SGDID:S000000404 Length:551 Species:Saccharomyces cerevisiae


Alignment Length:305 Identity:60/305 - (19%)
Similarity:101/305 - (33%) Gaps:73/305 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 SSDSNFSSPNNGSVSQPESGFEDDYHRSRPSTQSPLDPWEAVDSVGLGGVDSFGSAPVR----QT 336
            |:|.:..|.:||||                                   :....:.|||    .:
Yeast    21 SADISTPSHDNGSV-----------------------------------IKHIKTVPVRYLSSSS 50

  Fly   337 YQVQSRGSDNP--LCNGKSLLPPTQSLTMPTIIKPKISQKPKAPKPPPF-------IGGHLPPGY 392
            ..|:|:...:|  ..|.|.:..|.:      :||.|.|.:.:..|...|       :.|.....|
Yeast    51 TPVKSQRDSSPKNRHNSKDITSPEK------VIKAKYSYQAQTSKELSFMEGEFFYVSGDEKDWY 109

  Fly   393 SIPSGYAGSE-TPPSPPMPKGPPPPPPPASSGGISLLDVINGKVDALALSNGCQGYMEEEVVPYA 456
            ...:...|.| ..|...........|...:....|...|.|..::..:|              ||
Yeast   110 KASNPSTGKEGVVPKTYFEVFDRTKPSSVNGSNSSSRKVTNDSLNMGSL--------------YA 160

  Fly   457 VALYDFDGIEPGDLSFREGEKIYLLDHPTPEWLRGRT--RSGCEGIFPINYVDIKVPLGATGGAA 519
            :.||||...:..:|:...||.:::..|...||...:.  |.|..|:.|:.:|.| :.: |||.|.
Yeast   161 IVLYDFKAEKADELTTYVGENLFICAHHNCEWFIAKPIGRLGGPGLVPVGFVSI-IDI-ATGYAT 223

  Fly   520 AAPTASAAAPSPSPSQQQLPTALCLYHFPGEVEGDLALQENELVT 564
            .............|:.|:..:.:..|.......|.:..|:.:.:|
Yeast   224 GNDVIEDIKSVNLPTVQEWKSNIARYKASNISLGSVEQQQQQSIT 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)05822NP_001262702.1 SH3 452..506 CDD:214620 16/55 (29%)
SH3 540..591 CDD:302595 4/25 (16%)
BEM1NP_009759.3 SH3_Bem1p_1 76..127 CDD:212811 11/50 (22%)
SH3_Bem1p_2 159..214 CDD:212812 17/54 (31%)
PX_Bem1p 284..400 CDD:132800
PB1 478..549 CDD:214770
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46655
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.