DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)05822 and RVS167

DIOPT Version :9

Sequence 1:NP_001262702.1 Gene:l(3)05822 / 47260 FlyBaseID:FBgn0010877 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_010676.1 Gene:RVS167 / 851996 SGDID:S000002796 Length:482 Species:Saccharomyces cerevisiae


Alignment Length:216 Identity:59/216 - (27%)
Similarity:83/216 - (38%) Gaps:59/216 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 GVDSFGSAPVRQTYQVQSRGSDNPLCNGKSLLPPTQSLTMPT-----IIKPKISQKPKAP----- 378
            ||.:...:||        .|:.:.:..|....|.|.:...||     ...|..:.:|.|.     
Yeast   292 GVATAEGSPV--------SGASSGVGYGAGYDPATATSPTPTGYGYGAAAPSYAAQPAAQYGTAA 348

  Fly   379 --KPPPFIG-------GHLPPGYSIPSGYAGSETPP--------SPPMPKGPPPP-PPPASSGGI 425
              .....:|       |.:|..|  |. ||.:::||        ||...:||||. ..|.:|   
Yeast   349 AVGTAAAVGTAAGAAAGAVPGTY--PQ-YAAAQSPPLTGLGFQQSPQQQQGPPPAYSNPLTS--- 407

  Fly   426 SLLDVINGKVDALALSNGCQGYMEEEVVPYAVALYDFDGIEPGDLSFREGEKIYLLDHPTP---E 487
               .|......|:|.:.|         |....||||:.....|||||..|..|.::.. ||   |
Yeast   408 ---PVAGTPAAAVAAAPG---------VETVTALYDYQAQAAGDLSFPAGAVIEIVQR-TPDVNE 459

  Fly   488 WLRGRTRSGCEGIFPINYVDI 508
            |..|| .:|.:|:||.|||.:
Yeast   460 WWTGR-YNGQQGVFPGNYVQL 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)05822NP_001262702.1 SH3 452..506 CDD:214620 23/56 (41%)
SH3 540..591 CDD:302595
RVS167NP_010676.1 BAR_Rvs167p 29..245 CDD:153283
SH3 425..478 CDD:418401 23/54 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46655
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.