DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)05822 and Ncf4

DIOPT Version :9

Sequence 1:NP_001262702.1 Gene:l(3)05822 / 47260 FlyBaseID:FBgn0010877 Length:600 Species:Drosophila melanogaster
Sequence 2:XP_006242001.1 Gene:Ncf4 / 500904 RGDID:1593157 Length:355 Species:Rattus norvegicus


Alignment Length:260 Identity:60/260 - (23%)
Similarity:92/260 - (35%) Gaps:76/260 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 RQTYQVQSRGSDNPLCNGKSLLPPTQSL-TMPTIIKPKISQKPKAPKPPPFIGGHLPPGYSIP-- 395
            ||.|.:||:..:......|: .|.|.|| |:|..:...:.|: .|....|.:..::....|:|  
  Rat    76 RQFYALQSKLEERFGPESKN-SPFTCSLPTLPAKVYMGVKQE-IAETRIPALNAYMKNLLSLPVC 138

  Fly   396 -------------SGYAGSETP-------PSPPMPKGPPPPPPPASSGGISLLDVINGKVDALAL 440
                         |.|...:.|       |.....||..|..|.                     
  Rat   139 VLMDPDVRIFFYQSAYDAEQVPQALRRLRPRTRKIKGVTPQGPS--------------------- 182

  Fly   441 SNGCQGYMEEEVVPYAVALYDFDGIEPGDLSFREGEKIYLLDHPTPEWLRGRTRSGCEGIFPINY 505
                   |:....|.|.||:||.|....:|||:.|:.|:||.....:||.|.|: |..||||.::
  Rat   183 -------MDRMEAPRAEALFDFTGNSKLELSFKAGDVIFLLSKINKDWLEGTTQ-GATGIFPGSF 239

  Fly   506 VDIKVPLGATGGAAAAPTASAAAPSPSPSQQQLPTALCLYHF--PGEVEGDLALQENELVTVLYR 568
            |.|.                    ...|..:.....|..|.:  .|:...|:|::|:...|.|::
  Rat   240 VKIL--------------------KDFPEDEDTTNWLRCYFYEDTGKTIKDIAVEEDLSSTPLFK 284

  Fly   569  568
              Rat   285  284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)05822NP_001262702.1 SH3 452..506 CDD:214620 23/53 (43%)
SH3 540..591 CDD:302595 8/31 (26%)
Ncf4XP_006242001.1 PX_p40phox 56..157 CDD:132792 19/82 (23%)
SH3_p40phox 190..243 CDD:212802 23/53 (43%)
PB1_P40 254..345 CDD:99721 8/31 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.