DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)05822 and ncf4

DIOPT Version :9

Sequence 1:NP_001262702.1 Gene:l(3)05822 / 47260 FlyBaseID:FBgn0010877 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_991274.2 Gene:ncf4 / 403014 ZFINID:ZDB-GENE-041124-1 Length:355 Species:Danio rerio


Alignment Length:77 Identity:25/77 - (32%)
Similarity:38/77 - (49%) Gaps:1/77 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   522 PTASAAAPSPSPSQQQLPTALCLYHFPGEVEGDLALQENELVTVLYRINEDWLYGEVAGRQGQFP 586
            ||.......|.......|.|..::.|.|....:|:|:..:::.:|.|:|.|||.|.|..|.|.||
Zfish   153 PTRKVKTVKPKTDLLSAPRAEAVFDFSGSGRLELSLKAGDVIFLLRRVNADWLEGTVRDRTGIFP 217

  Fly   587 ANFLDQVPANLP 598
            .:|:..:.| ||
Zfish   218 ESFVKIIKA-LP 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)05822NP_001262702.1 SH3 452..506 CDD:214620
SH3 540..591 CDD:302595 18/50 (36%)
ncf4NP_991274.2 PX_p40phox 19..141 CDD:132792
SH3_p40phox 171..224 CDD:212802 18/52 (35%)
PB1_P40 250..345 CDD:99721
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.