DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmGlut and VHT1

DIOPT Version :9

Sequence 1:NP_620115.2 Gene:dmGlut / 47253 FlyBaseID:FBgn0010497 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_011579.1 Gene:VHT1 / 852956 SGDID:S000003297 Length:593 Species:Saccharomyces cerevisiae


Alignment Length:459 Identity:81/459 - (17%)
Similarity:137/459 - (29%) Gaps:138/459 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ILNAYTMRVCLSQAITVLVVKKNSTDDDSEAICEPDDIDEGTSV-GGDFEWSEELQGLILSSFYI 94
            |:..|...:|.|:::.:    .|.|:      ....::.|..:: |.|:.::..:..       :
Yeast   128 IIALYFFMLCWSKSVDL----NNYTN------AYVSNMKEDLNMKGNDYVYTSTIAN-------V 175

  Fly    95 GYIVTHIPGGLLAEKFGGKWTLGLGILSTAVFTMLTPLAINKGDSDWLIVTRVLMGLGEGTTFPA 159
            |.||..:|...|..:|.....|.:..|....||.....|.:..:   |...|.::.......:|.
Yeast   176 GAIVFQLPFMYLLPRFPSHIILPVMDLGWTWFTFACYRANSLAE---LRAYRFILSAFGAAYYPV 237

  Fly   160 LSVLLAAWVPANERGKLGALVLGGGQVGTIMGNLL-SGVFIDAYGWEFVFYFFGGLGVVWFAIFM 223
            ...:|..|...:|......|...|.|:|::...|| |.:|....|      ..|..|..|..:..
Yeast   238 SQYILGCWYAPDEINSRVCLFFCGQQLGSVTSGLLQSRIFKSLNG------VHGLAGWRWMFLID 296

  Fly   224 FLCYSDPTS--HPFIKPSERE-----YLVKEIGTISR-------------NEDLPP----TPWKA 264
            .:..|.||:  ..|:.|....     :|..|...|:|             ...|.|    ..||.
Yeast   297 AIAISLPTAIIGFFVIPGVPSKCYSLFLTDEEIRIARARNKRNQIKDGVDKSKLAPLWSRKLWKK 361

  Fly   265 ILTNLPMFALVAAQIGHDWGFYIMVTDLPKYMADVLQFSIKANGLYSSLPYVMMWIVSVGSGFVA 329
            :... |.|.::.......|      .::..|......: :|:|..||                  
Yeast   362 VFCT-PAFWVLVVFDTCSW------NNMTAYSGSYTLW-LKSNTKYS------------------ 400

  Fly   330 DWMIRRGVLSTTNTRKVMTGLAAFGPAIFMV-GASYAGCDRVLVVVLFTICMGLMGAYYAGMKLS 393
                    ::..|...|:.....|...||.. ||....|..:.:|                    
Yeast   401 --------IAQVNNLSVIPACLGFAYVIFCAFGADLFRCKWIFMV-------------------- 437

  Fly   394 PLDMSPNYAGTLMAITNGIGAITGVITPYLVGVMTPNASLLEWRL---VFWVAFGVLCFT-AVIY 454
                       ..||.|.:..                |.|::|.:   ..|.||....|: |...
Yeast   438 -----------FAAIMNTVSC----------------ALLIKWDIPSKAKWYAFFTTYFSVAASP 475

  Fly   455 CIWA 458
            |:|:
Yeast   476 CLWS 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmGlutNP_620115.2 2A0114euk 25..463 CDD:129972 81/459 (18%)
MFS 77..458 CDD:119392 72/410 (18%)
VHT1NP_011579.1 MFS_FEN2_like 124..542 CDD:340885 81/459 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.