DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmGlut and PHT4;2

DIOPT Version :9

Sequence 1:NP_620115.2 Gene:dmGlut / 47253 FlyBaseID:FBgn0010497 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001325125.1 Gene:PHT4;2 / 818384 AraportID:AT2G38060 Length:561 Species:Arabidopsis thaliana


Alignment Length:406 Identity:109/406 - (26%)
Similarity:192/406 - (47%) Gaps:60/406 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VIPQRVILAIMG--FLAILNAYTMRVCLSQAITVLVVKKNSTDDDSEAICEPDDIDEGTSVGGDF 78
            ::|:|:.:.|:.  .:.:.||  .||.:|.|:..|..|                          .
plant    94 MMPERIKVVILTACMMCLCNA--DRVVMSVAVVPLADK--------------------------L 130

  Fly    79 EWSEELQGLILSSFYIGYIVTHIPGGLLAEKFGGKWTLGLGILSTAVFTMLTPLAINKGDSDW-- 141
            .||....|::.|||..|||.:.:.||.|.:::|||..|..|:...::.|:|||         |  
plant   131 GWSSSFLGVVQSSFLWGYIFSSVIGGALVDRYGGKRVLAWGVALWSLATLLTP---------WAA 186

  Fly   142 ------LIVTRVLMGLGEGTTFPALSVLLAAWVPANERGKLGALVLGGGQVGTIMGNLLSGVFID 200
                  |:..|...||.||...|:::.||:.|.|.:||.....:.:.|..:|.::|.||:.:.:.
plant   187 AHSTLALLCVRAFFGLAEGVAMPSMTTLLSRWFPMDERASAVGISMAGFHMGNVVGLLLTPLMLS 251

  Fly   201 AYGWEFVFYFFGGLGVVWFAIFMFLCYSDPTSHPFIKPSEREYLVKEIGTISRNEDLPPTP---W 262
            :.|....|..|..||::|.:.:.....::|...|||..||...:  :.|...:...:.|.|   .
plant   252 SIGISGPFILFASLGLLWVSTWSSGVTNNPQDSPFITRSELRLI--QAGKPVQPSTISPKPNPSL 314

  Fly   263 KAILTNLPMFALVAAQIGHDWGFYIMVTDLPKYMADVLQFSIKANGLYSSLPYVMMWIVSVGSGF 327
            :.:|:.||.:|::.|.:.::||::::::.:|.|...|...::|....:|:||:..|.|....:|.
plant   315 RLLLSKLPTWAIIFANVTNNWGYFVLLSWMPVYFQTVFNVNLKQAAWFSALPWATMAISGYYAGA 379

  Fly   328 VADWMIRRGVLSTTNTRKVMTGLAAFGPAIFMVGASYA---GCDRVLVVVLFTICMGLMGAYYAG 389
            .:|::||.| .|.|:.||:|..:...||.:.::..::|   .|    ..|..||.:.|.....||
plant   380 ASDFLIRTG-HSVTSVRKIMQSIGFMGPGLSLLCLNFAKSPSC----AAVFMTIALSLSSFSQAG 439

  Fly   390 MKLSPLDMSPNYAGTL 405
            ..|:..|::|.|||.|
plant   440 FLLNMQDIAPQYAGFL 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmGlutNP_620115.2 2A0114euk 25..463 CDD:129972 107/397 (27%)
MFS 77..458 CDD:119392 98/343 (29%)
PHT4;2NP_001325125.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 1 1.000 - - mtm8397
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11662
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.870

Return to query results.
Submit another query.