DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmGlut and SLC17A6

DIOPT Version :9

Sequence 1:NP_620115.2 Gene:dmGlut / 47253 FlyBaseID:FBgn0010497 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_065079.1 Gene:SLC17A6 / 57084 HGNCID:16703 Length:582 Species:Homo sapiens


Alignment Length:499 Identity:162/499 - (32%)
Similarity:249/499 - (49%) Gaps:47/499 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FVIPQRVILAIMGFLAILNAYTMRVCLSQAITVLVVKKNSTDDDSEAICEPDDIDEGTSV---GG 76
            |.:|:|.|:|||..|....::.:|..|..||..:|  .|||            |..|..|   ..
Human    65 FGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMV--NNST------------IHRGGKVIKEKA 115

  Fly    77 DFEWSEELQGLILSSFYIGYIVTHIPGGLLAEKFGGKWTLGLGILSTAVFTMLTPLA--INKGDS 139
            .|.|..|..|:|..||:.|||:|.||||.:|.:.......|..||.|:...||.|.|  ::.|  
Human   116 KFNWDPETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARVHYG-- 178

  Fly   140 DWLIVTRVLMGLGEGTTFPALSVLLAAWVPANERGKLGALVLGGGQVGTIMGNLLSGVFIDAYGW 204
             .:|..|:|.||.||.|:||...:.:.|.|..||.:|......|...|.::...|:|:.:...||
Human   179 -CVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGW 242

  Fly   205 EFVFYFFGGLGVVWFAIFMFLCYSDPTSHPFIKPSEREYLVKEIGTISRN----EDLPPTPWKAI 265
            ..|||.:|..|:||:..::.:.|..|..||.|...||.|:.:.||. |.|    .:...|||:..
Human   243 SSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERRYIEESIGE-SANLLGAMEKFKTPWRKF 306

  Fly   266 LTNLPMFALVAAQIGHDWGFYIMVTDLPKYMADVLQFSIKANGLYSSLPYVMMWIVSVGSGFVAD 330
            .|::|::|::.|.....|.||:::...|.|..:|..|.|...|:.|::|:::|.|:....|.:||
Human   307 FTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIAD 371

  Fly   331 WMIRRGVLSTTNTRKVMT--GLAAFGPAIFMVGASYAGCDRVLVVVLFTICMGLMGAYYAGMKLS 393
            ::..:.:||||..||:|.  |.......:.:||.|:.   |.:.:....:.:|..|...:|..::
Human   372 FLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHT---RGVAISFLVLAVGFSGFAISGFNVN 433

  Fly   394 PLDMSPNYAGTLMAITNGIGAITGVITPYLVGVMTPNASLLEWRLVFWVAFGVLCFTAVIYCIWA 458
            .||::|.||..||.|:||:|.::|::.|.:||.||.|.|..||:.||.:|..|.....:.|.|:|
Human   434 HLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKNKSREEWQYVFLIAALVHYGGVIFYAIFA 498

  Fly   459 SGEVQPFNNAPIQPRSVDFEAQERKVG-------GEKTSGLEQS 495
            |||.||:.:..        |..|.|.|       .|:|..:.|:
Human   499 SGEKQPWADPE--------ETSEEKCGFIHEDELDEETGDITQN 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmGlutNP_620115.2 2A0114euk 25..463 CDD:129972 148/448 (33%)
MFS 77..458 CDD:119392 130/388 (34%)
SLC17A6NP_065079.1 MFS_SLC17A6_7_8_VGluT 74..498 CDD:340940 145/444 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148709
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1866
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.