DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmGlut and SLC17A7

DIOPT Version :9

Sequence 1:NP_620115.2 Gene:dmGlut / 47253 FlyBaseID:FBgn0010497 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_064705.1 Gene:SLC17A7 / 57030 HGNCID:16704 Length:560 Species:Homo sapiens


Alignment Length:500 Identity:163/500 - (32%)
Similarity:255/500 - (51%) Gaps:53/500 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FVIPQRVILAIMGFLAILNAYTMRVCLSQAITVLVVKKNSTDDDSEAICEPDDIDEGTSVGG--- 76
            |.:|:|.|:|||..|....::.:|..|..||..:|  .|||                |..||   
Human    57 FGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMV--NNST----------------THRGGHVV 103

  Fly    77 ----DFEWSEELQGLILSSFYIGYIVTHIPGGLLAEKFGGKWTLGLGILSTAVFTMLTPLA--IN 135
                .|.|..|..|||..||:.|||||.||||.:.:||......|..|::|:...||.|.|  ::
Human   104 VQKAQFSWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVH 168

  Fly   136 KGDSDWLIVTRVLMGLGEGTTFPALSVLLAAWVPANERGKLGALVLGGGQVGTIMGNLLSGVFID 200
            .|   .:|..|:|.||.||.|:||...:.:.|.|..||.:|......|...|.::...|:||.:.
Human   169 YG---CVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQ 230

  Fly   201 AYGWEFVFYFFGGLGVVWFAIFMFLCYSDPTSHPFIKPSEREYLVKEIGTISRNEDLPP-----T 260
            ..||..|||.:|..|:.|:..::.:.|..|..||.|...||:|:...||..::.  :.|     |
Human   231 YSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKL--MNPLTKFST 293

  Fly   261 PWKAILTNLPMFALVAAQIGHDWGFYIMVTDLPKYMADVLQFSIKANGLYSSLPYVMMWIVSVGS 325
            ||:...|::|::|::.|.....|.||:::...|.|..:|..|.|...||.|:||:::|.|:....
Human   294 PWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIG 358

  Fly   326 GFVADWMIRRGVLSTTNTRKVMT--GLAAFGPAIFMVGASYAGCDRVLVVVLFTICMGLMGAYYA 388
            |.:||::..|.::||||.||:|.  |.......:.:||.|::   :.:.:....:.:|..|...:
Human   359 GQIADFLRSRRIMSTTNVRKLMNCGGFGMEATLLLVVGYSHS---KGVAISFLVLAVGFSGFAIS 420

  Fly   389 GMKLSPLDMSPNYAGTLMAITNGIGAITGVITPYLVGVMTPNASLLEWRLVFWVAFGVLCFTAVI 453
            |..::.||::|.||..||.|:||:|.::|::.|.:||.||.:.:..||:.||.:|..|.....:.
Human   421 GFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIF 485

  Fly   454 YCIWASGEVQPFNNAPIQPRSVDFEAQERK---VGGEKTSGLEQS 495
            |.::||||.||:    .:|.    |..|.|   ||.::.:|.:.|
Human   486 YGVFASGEKQPW----AEPE----EMSEEKCGFVGHDQLAGSDDS 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmGlutNP_620115.2 2A0114euk 25..463 CDD:129972 148/453 (33%)
MFS 77..458 CDD:119392 130/389 (33%)
SLC17A7NP_064705.1 MFS_SLC17A6_7_8_VGluT 66..490 CDD:340940 145/449 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 497..560 7/33 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148581
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1866
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.