DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmGlut and slc37a4b

DIOPT Version :9

Sequence 1:NP_620115.2 Gene:dmGlut / 47253 FlyBaseID:FBgn0010497 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001315024.1 Gene:slc37a4b / 393914 ZFINID:ZDB-GENE-040426-827 Length:453 Species:Danio rerio


Alignment Length:448 Identity:88/448 - (19%)
Similarity:170/448 - (37%) Gaps:120/448 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SVGGDFEWSEELQGLILSSFYIGYIVTHIPGGLLAEKFGGKW--TLGLGILST-----------A 124
            ||..:.|..:|..|||.||..:.|.::....|:|:::...:|  ::||.|:.|           .
Zfish    37 SVMEEIELDKEELGLITSSQTLAYAISKFISGVLSDRISARWLFSIGLFIVGTINIAFSCSSTVM 101

  Fly   125 VFTMLTPLAINKGDSDWLIVTRVLMGLGEGTTFPALSVLLAAWVPANERGKLGALVLGGGQVGTI 189
            :||:|           |.:     .|.|:|..:|....:|..|...::.|...|::.....:...
Zfish   102 LFTVL-----------WFV-----NGFGQGFGWPPCGKVLRKWFEPSQFGTWWAILCCSMNLAGS 150

  Fly   190 MGNLLSGVFIDAYGWEFVFYFFGGLGVVWFAIFMFLCYSDPT--SHPFIKPSEREYLVKEIGTIS 252
            :|.:::.|.:..|.|..:....|.:.:....:.:.:..::|:  ..|.|:|..::...|:.|.  
Zfish   151 LGPIITTVLVQYYDWRVIMSVSGLICMAVAVVCLLMVKNEPSDVGLPSIQPGAKKGKGKKGGP-- 213

  Fly   253 RNED-------LPPTPWKAILTNLPMFALVAAQIGHDWG--FYIMVTDLPKYMADVLQFSIKANG 308
             |::       |.|..|......|.:|.:..|..  |||  |.:........|......:::..|
Zfish   214 -NDESSLKDFLLSPYLWVLSAGYLVVFGVKIACT--DWGQLFLMQEKGQSAMMGSSYMSALEVGG 275

  Fly   309 LYSSLPYVMMWIVSVGSGFVADWMI-RRGVLSTTNTR-----KVMTGLA---------------- 351
            .:.          |:|:|:::|..: |:|:....|.|     .:|.|:|                
Zfish   276 FFG----------SIGAGYLSDRAVARQGLGVYGNPRHGLLLMMMAGMAVSMYLFRVTITPETPE 330

  Fly   352 -------AFGPAIFMVGASYAGCDRVLVVVLFTICMGLMGAYYAGMKLSPL--------DMSP-N 400
                   |..|...:.|.|    ::.|.::       ::||.:......|:        :.:| |
Zfish   331 EAPLWVLALHPVSVLTGVS----EKELWIL-------ILGAAFGFSSYGPIALFGVIASESAPSN 384

  Fly   401 YAGT---LMAITNGIGAITGVITPYLVGV-MTPNASLLEWRLVFWV-----AFGVLCF 449
            :.||   ::|:...:||       ::.|: .:..|....|...|||     |...:||
Zfish   385 FCGTSHAIVALMANVGA-------FIAGLPFSTIAKRYSWDTAFWVAEVSCAITTVCF 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmGlutNP_620115.2 2A0114euk 25..463 CDD:129972 88/448 (20%)
MFS 77..458 CDD:119392 86/444 (19%)
slc37a4bNP_001315024.1 UhpC 18..421 CDD:332119 82/432 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582620
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.