DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmGlut and Slc17a9

DIOPT Version :9

Sequence 1:NP_620115.2 Gene:dmGlut / 47253 FlyBaseID:FBgn0010497 Length:496 Species:Drosophila melanogaster
Sequence 2:XP_038961483.1 Gene:Slc17a9 / 362287 RGDID:1311940 Length:448 Species:Rattus norvegicus


Alignment Length:288 Identity:87/288 - (30%)
Similarity:151/288 - (52%) Gaps:27/288 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 DFEWSEELQGLILSSFYIGYIVTHIPGGLLAEKFGGKWTLGLGILSTAVFTMLTPLAINKGDSDW 141
            ||.|:::..|::||||:.||.:|.:.||.|.::.||:..:.|...:....|:.|||..:.|....
  Rat    65 DFGWNKKEAGIVLSSFFWGYCLTQVVGGHLGDRIGGEKVILLSASAWGFITVTTPLLAHLGSGHL 129

  Fly   142 LIVT--RVLMGLGEGTTFPALSVLLAAWVPANERGKLGALVLGGGQVGTIMGNLLSGVFIDAYGW 204
            ..||  |:|.||.:|..||||:.||:..|..:||....:.|..|.||||::...:..|.:|..||
  Rat   130 AFVTFSRILTGLLQGVYFPALTSLLSQRVQESERSFTYSTVGAGSQVGTLVTGGIGSVLLDRCGW 194

  Fly   205 EFVFYFFGGLGVVW-FAIFMFLCYSDPTSHPFIKPSEREYLVKEIGTISRNEDLPPT-----PWK 263
            :.||||.|||.::| :.::.:|.             :.:.||..:|.::  :.||.|     ||:
  Rat   195 QSVFYFSGGLTLLWVYYVYKYLL-------------DEKDLVLALGVLA--QGLPVTRPSKVPWR 244

  Fly   264 AILTNLPMFALVAAQIGHDWGFYIMVTDLPKYMADVLQFSIKANGLYSSLPYVMMWIVSVGSGFV 328
            .:.....::|::.:|:.....|:|:::.||.:..:.  |......:::.:|:::....|:.|||:
  Rat   245 QLFRKASVWAVICSQLSSACSFFILLSWLPTFFKET--FPHSKGWVFNVVPWLLAIPASLFSGFI 307

  Fly   329 ADWMIRRGVLSTTNTRKVMTGL-AAFGP 355
            :|.:|.:|....| .||.|... |..||
  Rat   308 SDRLISQGYRVIT-VRKFMQPCPAGHGP 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmGlutNP_620115.2 2A0114euk 25..463 CDD:129972 87/288 (30%)
MFS 77..458 CDD:119392 87/288 (30%)
Slc17a9XP_038961483.1 MFS 38..>326 CDD:421695 83/278 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.