DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmGlut and MFS18

DIOPT Version :9

Sequence 1:NP_620115.2 Gene:dmGlut / 47253 FlyBaseID:FBgn0010497 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_608835.1 Gene:MFS18 / 33650 FlyBaseID:FBgn0025684 Length:439 Species:Drosophila melanogaster


Alignment Length:416 Identity:101/416 - (24%)
Similarity:183/416 - (43%) Gaps:71/416 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 EWSEELQGLILSSFYIGYIVTHIPGGLLAEKFGGKWTLGLGILSTAVFTMLTPLAINKGDS---- 139
            :||:...|.:||||:.||.:|.:.||..:::|||:..:....:..::.|.|.|..|....|    
  Fly    59 KWSKTDSGTVLSSFFWGYTLTQVVGGYFSDRFGGQRVILFAAIGWSLITFLMPTIIWTAGSIKSY 123

  Fly   140 --DWLIVTRVLMGLGEGTTFPALSVLLAAWVPANERGKLGALVLGGGQVGTIMGNLLSGVFIDAY 202
              .:::..|:|.|..:|..||::..|.:..:..|||.....|:..|..:||::..::....:|.:
  Fly   124 AIPFIVAIRILNGALQGVHFPSMISLTSQNLCPNERSSFFGLLTAGSALGTLLTGIMGSFLLDYF 188

  Fly   203 GWEFVFYFFGGLGVVWFAIFMFLCYSDPTSHPFIKPSEREYLVKEIGTISR---NEDLPPT---P 261
            ||.:||...|.:|:.|..:..:          :....||..:: .|.|.||   |:....|   |
  Fly   189 GWSYVFRVIGLMGIAWALVLRY----------YAMAGERNRII-NIATPSRLCANKSPAETSAVP 242

  Fly   262 WKAILTNLPMFALVAAQIGHDWGFYIMVTDLPKYMADVLQFSIKANGLYSSLPYVMMWIVSVGSG 326
            |......|..:|.|.........|:::::.||.|..|             ..|:...|:|:    
  Fly   243 WLRYFRRLSFWACVLTHACEMNCFFVLLSWLPTYFHD-------------GFPHAKGWVVN---- 290

  Fly   327 FVADWM-----------IRRGVLS----TTNTRKVMTG--LAAFGPAIFMVGASYAGCDRVLVVV 374
             :..|:           :...:|:    ||..|||:..  .||...|:|::..:   .|....::
  Fly   291 -MIPWLALPPCTLFAKYLTTRLLAREWHTTTVRKVIQSCCFAAQNLALFVMSRT---SDFHTALI 351

  Fly   375 LFTICMGLMGAYYAGMKLSPLDMSPNYAGTLMAITNGIGAITGVITPYLVGVMTPNASLLE---- 435
            ..||.:|..|.:...:.::|.|::|.::|::..:.|.:|||.|.:..||.|      .:||    
  Fly   352 CMTIIIGGTGFHNNAVTVNPQDLAPLHSGSVFGLMNTVGAIPGFLGVYLAG------HILELTQS 410

  Fly   436 WRLVFWVAFGVLCFTAVIYCIWASGE 461
            |.:||..|.|:.....:|:.::.|.|
  Fly   411 WPMVFSAAAGINLVGWIIFIVFGSAE 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmGlutNP_620115.2 2A0114euk 25..463 CDD:129972 101/416 (24%)
MFS 77..458 CDD:119392 99/411 (24%)
MFS18NP_608835.1 MFS 30..432 CDD:119392 99/410 (24%)
MFS_1 32..397 CDD:284993 88/369 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452013
Domainoid 1 1.000 116 1.000 Domainoid score I288
eggNOG 1 0.900 - - E1_KOG2532
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I245
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.