DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmGlut and Slc17a8

DIOPT Version :9

Sequence 1:NP_620115.2 Gene:dmGlut / 47253 FlyBaseID:FBgn0010497 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_714947.1 Gene:Slc17a8 / 266767 RGDID:628870 Length:588 Species:Rattus norvegicus


Alignment Length:456 Identity:150/456 - (32%)
Similarity:231/456 - (50%) Gaps:29/456 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IPQRVILAIMGFLAILNAYTMRVCLSQAITVLVVKKNST---DDDSEAICEPDDIDEGTSVGGDF 78
            ||:|.|:|:|..|....::.:|..|..||..:|  .|||   |...|.            ....|
  Rat    72 IPKRYIIAVMSGLGFCISFGIRCNLGVAIVEMV--NNSTVYVDGKPEI------------QTAQF 122

  Fly    79 EWSEELQGLILSSFYIGYIVTHIPGGLLAEKFGGKWTLGLGILSTAVFTMLTPLA--INKGDSDW 141
            .|..|..|||..||:.|||||.||||.::.||......|..|..|:...|..|.|  ::.|   .
  Rat   123 NWDPETVGLIHGSFFWGYIVTQIPGGFISNKFAANRVFGAAIFLTSTLNMFIPSAARVHYG---C 184

  Fly   142 LIVTRVLMGLGEGTTFPALSVLLAAWVPANERGKLGALVLGGGQVGTIMGNLLSGVFIDAYGWEF 206
            ::..|:|.||.||.|:||...:.:.|.|..||.:|......|...|.::...|:||.:...||..
  Rat   185 VMCVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVLVQYIGWAS 249

  Fly   207 VFYFFGGLGVVWFAIFMFLCYSDPTSHPFIKPSEREYLVKEIGTISRNEDLPP--TPWKAILTNL 269
            |||.:|..|::|:..::...|..|..||.|...||.|:...||..:....|..  |||:...|:|
  Rat   250 VFYIYGMFGIIWYMFWLLQAYECPAVHPTISNEERTYIETSIGEGANLASLSKFNTPWRRFFTSL 314

  Fly   270 PMFALVAAQIGHDWGFYIMVTDLPKYMADVLQFSIKANGLYSSLPYVMMWIVSVGSGFVADWMIR 334
            |::|::.|.....|.||:::...|.|..:|..|:|...||.|::|:::|.||....|.:||::..
  Rat   315 PVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSAVPHMVMTIVVPIGGQLADYLRS 379

  Fly   335 RGVLSTTNTRKVMT--GLAAFGPAIFMVGASYAGCDRVLVVVLFTICMGLMGAYYAGMKLSPLDM 397
            |.:|:||..||:|.  |.......:.:||.|:.   :.:.:....:.:|..|...:|..::.||:
  Rat   380 RKILTTTAVRKIMNCGGFGMEATLLLVVGFSHT---KGVAISFLVLAVGFSGFAISGFNVNHLDI 441

  Fly   398 SPNYAGTLMAITNGIGAITGVITPYLVGVMTPNASLLEWRLVFWVAFGVLCFTAVIYCIWASGEV 462
            :|.||..||.|:||:|.::|::.|.:||.||.:.:..||:.||.:|..|.....:.|.::||||.
  Rat   442 APRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQNVFLIAALVHYSGVIFYGVFASGEK 506

  Fly   463 Q 463
            |
  Rat   507 Q 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmGlutNP_620115.2 2A0114euk 25..463 CDD:129972 144/446 (32%)
MFS 77..458 CDD:119392 128/386 (33%)
Slc17a8NP_714947.1 MFS_SLC17A6_7_8_VGluT 79..502 CDD:340940 141/442 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 539..588
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342512
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.