DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmGlut and mfs2

DIOPT Version :9

Sequence 1:NP_620115.2 Gene:dmGlut / 47253 FlyBaseID:FBgn0010497 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_592802.1 Gene:mfs2 / 2542991 PomBaseID:SPAC11D3.05 Length:546 Species:Schizosaccharomyces pombe


Alignment Length:245 Identity:55/245 - (22%)
Similarity:94/245 - (38%) Gaps:70/245 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 SEREYLVKEIGTISRNEDLPPTPWKAILTNLPMFALVAAQIGHDWGFYI-----MVTDLPKYMAD 298
            :|.:|||...|.   ::.|.|..|                 .|.:.::|     ::|.:..:.:.
pombe    80 AEDQYLVTWDGP---DDPLNPRNW-----------------SHSYKWWIVIQVSVITIVVTFASS 124

  Fly   299 VLQFSI--KANGLYSSLPYVMMWIVSVGSGFVADWMIRRGV-------LSTTNTRKVMTGLAAFG 354
            |....|  .|:.|:||:|     :.::||   ..:::..||       ||....|.::..:....
pombe   125 VYSSGIIDIASELHSSIP-----VSTLGS---CTFLVGFGVGSLPFAPLSDIYGRFIIYFVTLLI 181

  Fly   355 PAIFMVGASYAGC-DRVLVVVLFTICMGLMGAYYAGMKLSPLDMSPNYAGTLMAITNGIG---AI 415
            ..||.||   .|| ..|..:.:.....|:.|:       :||   .|..||:..:...:.   .:
pombe   182 FTIFQVG---GGCAHNVWTLAIVRFFQGVFGS-------TPL---ANAGGTISDLFTPVQRTYVL 233

  Fly   416 TGVIT-PYLVGVMTP------NASLLEWRLVFWV----AFGVLCFTAVIY 454
            .|..| |||..::.|      ..|.||||..||:    |..|:.|..:.:
pombe   234 PGFCTFPYLGPIIGPIIGDFITQSYLEWRWTFWINMIWAAAVIVFVFIFF 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmGlutNP_620115.2 2A0114euk 25..463 CDD:129972 55/245 (22%)
MFS 77..458 CDD:119392 55/245 (22%)
mfs2NP_592802.1 MFS 109..530 CDD:119392 45/196 (23%)
MFS_1 112..493 CDD:284993 45/193 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.