DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmGlut and SPBC1348.05

DIOPT Version :9

Sequence 1:NP_620115.2 Gene:dmGlut / 47253 FlyBaseID:FBgn0010497 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_592767.1 Gene:SPBC1348.05 / 2542935 PomBaseID:SPBC1348.05 Length:485 Species:Schizosaccharomyces pombe


Alignment Length:417 Identity:82/417 - (19%)
Similarity:162/417 - (38%) Gaps:94/417 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 TSVGGDFEWSEELQGLILSSFYIGYIVTHIPGGLLAEKFGGKWTLGLGILSTAVFTML-TPLAIN 135
            :::...|..|..|..|..:.:.:|.:..::....|:|:||.:   .:.::..:||.:| .|:|::
pombe    67 SNIAEQFHASRTLVTLGATLYTLGILFGNLIFAPLSEQFGRR---PIYLIGYSVFALLQIPIALS 128

  Fly   136 KGDSDWLIVTRVLMGL--------GEGTTFPALSVLLAAWVPANERGKLGALVLGGGQVGTIMGN 192
            ...:.:| |.|...||        |.|:        ||......:|||...:......:|..:..
pombe   129 VNLAMFL-VFRFFSGLFGSVGLSNGSGS--------LADLFEKKDRGKYMVIYFTVLSIGPGIAP 184

  Fly   193 LLSGVFI--DAYGWEFVFY---FFGGLGVVWFAIFMFLCY-----------------SDPTSHPF 235
            ::|| ||  .:.||::.|:   ...|..:.|..:.:...|                 ::|.:   
pombe   185 IISG-FISQSSIGWQWEFWILLILSGFNLFWAFLLLKETYPPVLNRKKFEKYGEIGENEPVA--- 245

  Fly   236 IKPSEREYLVKEIGTISRNEDLPPTPWKAILTNLPMFALVAAQIGHDWGFYIMVT---------- 290
            ::.:.::.|:|.:..:|..:.:      :||.:.|:...||..||..:|...:|.          
pombe   246 LRLTGKQLLIKLLILLSMKKPI------SILLSQPILICVACTIGSIYGMINLVLIAFSEVWKSS 304

  Fly   291 -DLPKYMADVLQFSIKANGLYSSLPYVMMWIVSVGSGFVADWMIRRGVLSTTNTRKVMTGLAAFG 354
             |....::.::..||.. ||:|:: ::.|   .:...|.:..:.|.|.......|..|   ...|
pombe   305 YDFSPGISGLMYISITL-GLFSAV-FIAM---PINQKFYSYLVKRNGGEGEPEFRLPM---GFIG 361

  Fly   355 PAIFMVGASYAGCDRVLVVVLF--TICMGLMGAYYAGMKLSPLDMSPNYAGTLMAITNGIGAITG 417
            ..:|.:|....|......:..|  ||...:||..|. |..:||:|.                   
pombe   362 ITLFEIGILLFGWTARYKIFWFVPTIGSAIMGGGYI-MTSNPLNMY------------------- 406

  Fly   418 VITPYLVGVMTPNASLLEWRLVFWVAF 444
            |:..|.:...:.:|.:..::|:|...|
pombe   407 VVDSYGIYSASASAGVKIFQLLFGAIF 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmGlutNP_620115.2 2A0114euk 25..463 CDD:129972 82/417 (20%)
MFS 77..458 CDD:119392 82/412 (20%)
SPBC1348.05NP_592767.1 MFS 45..468 CDD:119392 82/417 (20%)
MFS_1 48..422 CDD:284993 79/404 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.