DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmGlut and SPAC1B3.15c

DIOPT Version :9

Sequence 1:NP_620115.2 Gene:dmGlut / 47253 FlyBaseID:FBgn0010497 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_594800.1 Gene:SPAC1B3.15c / 2542116 PomBaseID:SPAC1B3.15c Length:628 Species:Schizosaccharomyces pombe


Alignment Length:388 Identity:85/388 - (21%)
Similarity:142/388 - (36%) Gaps:96/388 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 YIGYIVTHIPGGLLAEKFGGKWTLGLGILSTAVFTMLTPLAINKGDS-DWLIVTRVLMGLGEGTT 156
            |:..|:..:|..||..:...:..|....::|.:......:...||.| ...|..|...||.....
pombe   209 YVSLIIFDLPSNLLMTRADPRLWLSRIQVTTGIIGACHAVLGTKGSSASGFIALRFFNGLAIAGM 273

  Fly   157 FPALSVLLAAWVPANERGKLGALVLGGGQVGTIMGNLLSGVF--IDA----YGWEFVFYFFGGLG 215
            :|..:...:.:......||.........|:.::..:|||..|  :|.    ||::::|..:   |
pombe   274 WPGFAFYTSRFYRDQHLGKRIGWYYTAAQISSVATSLLSAAFQKMDGLHGLYGYQWMFLIW---G 335

  Fly   216 VVWFAIFMFLCYSDPTSHPFIKPSERE-------YLVKEIGTISRNEDLPPTPWKAILTNLPMFA 273
            ||.|...:||    |...|.||.::..       .:.|.:|.:..:|:...||.:..:..:.|..
pombe   336 VVAFTQGLFL----PRWLPCIKHNQHNEKWISWIRIPKFLGFLKASENTGLTPEEEEVHAIYMAE 396

  Fly   274 LVAAQIGHDWGFYIMVTDLPKYMADV-------LQFSIK--ANGL--YSSLPYVMMWIVS-VGSG 326
            :   |:|..|    .:|||.....||       :.|.:.  :|||  ||||      |:| :...
pombe   397 M---QVGKSW----TLTDLADAFLDVRLWPPIFMFFGVVGISNGLVNYSSL------IISEINEN 448

  Fly   327 F--------VAD-WMIRRGVLSTT-----NTRKVMTGLAAFGPAIFMVGASYAGCDRVLVVVLFT 377
            |        ||. |:.....:.|.     ...|.|         :|.||:    |..||..:|.|
pombe   449 FSSVTVSLLVAPIWVFDAIAILTVLPLHDRFHKKM---------LFFVGS----CLFVLAGLLIT 500

  Fly   378 ICMGLMGAYYAGMKLSPLDMSPNY---------------------AGTLMAITNGIGAITGVI 419
            ..:..:...|.|:.:....:.|..                     ||  :||.:|:|.:..|:
pombe   501 TFVSNVWGRYVGLLILGFGLGPTVPIIMTWVSSAMGPSHGDVGVAAG--LAIVSGLGNLGSVV 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmGlutNP_620115.2 2A0114euk 25..463 CDD:129972 85/388 (22%)
MFS 77..458 CDD:119392 85/388 (22%)
SPAC1B3.15cNP_594800.1 MFS 158..600 CDD:119392 85/388 (22%)
2A0114 190..600 CDD:273326 85/388 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.