DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmGlut and SPCPB1C11.03

DIOPT Version :9

Sequence 1:NP_620115.2 Gene:dmGlut / 47253 FlyBaseID:FBgn0010497 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001342988.1 Gene:SPCPB1C11.03 / 2539453 PomBaseID:SPCPB1C11.03 Length:570 Species:Schizosaccharomyces pombe


Alignment Length:355 Identity:85/355 - (23%)
Similarity:130/355 - (36%) Gaps:114/355 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 FYIGYIVTHIPGGLLAEKFG-GKWTLGLGILSTAVFTMLTPLAINKGDSDWLIVTRVLMGLGEGT 155
            ||:||||...||..:.:.|. ||: :||...|.:|...|...|.|.|.   ||..|..:|..|..
pombe   146 FYVGYIVGQFPGHYIMQTFPLGKF-VGLVTFSWSVIVFLHCCAYNYGG---LIALRFFLGFTESC 206

  Fly   156 TFPALSVLLAAWVPANERGKLGALVLGGGQVGTIMGNLLSGVFIDAYGWEFV---------FYFF 211
            ..||:...:..:....|:..|..:.    .:..:...:.:| || |||.|||         |...
pombe   207 LLPAMEATMGMFFTHQEQAFLQPVF----WISCLSCGIPAG-FI-AYGLEFVTKSIAPWKLFMII 265

  Fly   212 GGLGVVWF-AIFMFLCYSD-PTSHPFIKPSEREYLVKEIGTISRN-------------EDL-PPT 260
            .| |:.:| :||:|..|.| |:...|:...|:.|.:..:...:|.             |.| .|.
pombe   266 TG-GITFFLSIFLFFYYPDNPSKARFLTDEEKLYTIDRVRKSTRGGIENKIFKKHQFIEALKDPI 329

  Fly   261 PWKAILTNLPMFALVAAQIGHDWGFYIMVTDLPKYMADVLQFSIKANGLYSSLP----------- 314
            .|        :|...|        |.:|:::...|..:::..|:..:.|.|:|.           
pombe   330 TW--------LFTFAA--------FTLMLSNNLAYQQNLIFTSLNVSDLNSTLVGVALAGYNTVS 378

  Fly   315 -----------------YVMMWI---VSVGSGFVA-DWMIRRGVL-------------------- 338
                             :.|.|:   ::.|..||| .|..|.|.|                    
pombe   379 AIIATFAMYLIPNQSAYHAMFWMLPSITGGIAFVALPWSNRIGELATMIIASDFGITYIIALGWT 443

  Fly   339 ---STTNTRKVMTGLAAFGPAIFMVGASYA 365
               ||..|:|:..||      :||||.:.|
pombe   444 TATSTGYTKKLTRGL------MFMVGYAIA 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmGlutNP_620115.2 2A0114euk 25..463 CDD:129972 85/355 (24%)
MFS 77..458 CDD:119392 85/355 (24%)
SPCPB1C11.03NP_001342988.1 UhpC 102..494 CDD:332119 85/355 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 69 1.000 Domainoid score I2672
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I1933
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.