DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmGlut and Slc37a4

DIOPT Version :9

Sequence 1:NP_620115.2 Gene:dmGlut / 47253 FlyBaseID:FBgn0010497 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001344658.1 Gene:Slc37a4 / 14385 MGIID:1316650 Length:450 Species:Mus musculus


Alignment Length:473 Identity:94/473 - (19%)
Similarity:175/473 - (36%) Gaps:103/473 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FLAILNAYTM----RVCLSQAITVLVVKKNSTDDDSEAICEPDDIDEGTSVGGDFEWSEELQGLI 88
            |.|:...|::    |...|..:..||         .|...:.||:                 |||
Mouse    14 FAAMFGGYSLYYFNRKTFSFVMPSLV---------DEIALDKDDL-----------------GLI 52

  Fly    89 LSSFYIGYIVTHIPGGLLAEKFGGKWTLGLGILSTAVFTMLTPLA--INKGDSDWLIVTRVLMGL 151
            .||....|.::....|:|:::...:|....|:|...:..::...:  ::...:.|.     |.||
Mouse    53 TSSQSAAYAISKFVSGVLSDQMSARWLFSSGLLLVGLVNVVFSWSSTVSAFAALWF-----LNGL 112

  Fly   152 GEGTTFPALSVLLAAWVPANERGKLGALVLGGGQVGTIMGNLLSGVFIDAYGWEFVFYFFGGLGV 216
            .:|..:|....:|..|...::.|...|::.....:...:|.:|:.:...:|.|.......|.|.|
Mouse   113 AQGLGWPPCGKILRKWFEPSQFGTWWAVLSTSMNLAGSLGPILATILAQSYSWRSTLALSGALCV 177

  Fly   217 VWFAIFMFLCYSDPTS------HPFIKPSE-REYLVKEIGTISRNEDLPPTPWKAILTNLPMFAL 274
            |.....:.|.:::|..      .|  .||: ::...||..|:   :||..:|:..:|:...:...
Mouse   178 VVSFFCLLLIHNEPADVGLRNLDP--APSKGKKGSSKEESTL---QDLLLSPYLWVLSTGYLVVF 237

  Fly   275 VAAQIGHDWGFYIMVTDLPKYMADVLQFSIKANGLYSSLPYVMMWIVSVGSGFVAD-WMIRRGVL 338
            .......|||.:.::.:..:        |......|.|...|...:.|:.:|:::| .|.:.|:.
Mouse   238 GVKTCCTDWGQFFLIQERGQ--------SALVGSSYISALEVGGLVGSIAAGYLSDRAMAKAGLS 294

  Fly   339 STTNTRK-----VMTGLAA------------------FGPAIFMVGASYAGCDRVLVVVLFTICM 380
            ...|.|.     :|.|:||                  :.||:..: |...|.....:.:|     
Mouse   295 LYGNPRHGLLLLMMAGMAASMFLFRVTVTSDSPKDAFWTPALHPL-AELTGFTEHEIWIL----- 353

  Fly   381 GLMGAYYAGMKLSPLDM---------SPNYAGTLMAITNGIGAITGVITPYLVGV-MTPNASLLE 435
             ::||.:......|:.:         .||..||..||...:..:.|    :|.|: .:..|....
Mouse   354 -VLGAVFGFSSYGPIALFGVIANESAPPNLCGTSHAIVGLMANVGG----FLAGLPFSTIAKHYS 413

  Fly   436 WRLVFWVAFGVLCFTAVI 453
            |...|||| .|:|..:.:
Mouse   414 WSTAFWVA-EVVCGASTV 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmGlutNP_620115.2 2A0114euk 25..463 CDD:129972 94/473 (20%)
MFS 77..458 CDD:119392 84/420 (20%)
Slc37a4NP_001344658.1 MFS_SLC37A4 10..438 CDD:340901 94/473 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838795
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.