DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmGlut and slc17a6

DIOPT Version :9

Sequence 1:NP_620115.2 Gene:dmGlut / 47253 FlyBaseID:FBgn0010497 Length:496 Species:Drosophila melanogaster
Sequence 2:XP_004913390.1 Gene:slc17a6 / 101730310 XenbaseID:XB-GENE-1011394 Length:583 Species:Xenopus tropicalis


Alignment Length:463 Identity:154/463 - (33%)
Similarity:241/463 - (52%) Gaps:34/463 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FVIPQRVILAIMGFLAILNAYTMRVCLSQAITVLVVKKNSTDDDSEAICEPDDIDEGTSV---GG 76
            |.:|:|.|:|||..|....::.:|..|..||..:|  .|||            |..|..:   ..
 Frog    65 FGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMV--NNST------------IHHGGKIIKEKA 115

  Fly    77 DFEWSEELQGLILSSFYIGYIVTHIPGGLLAEKFGGKWTLGLGILSTAVFTMLTPLA--INKGDS 139
            .|.|..|:.|:|..||:.|||||.||||.:|.:.......|..|:.|:...||.|.|  ::.|  
 Frog   116 KFNWDPEIVGMIHGSFFWGYIVTQIPGGYIASRLAANRVFGAAIVLTSTLNMLIPSAARVHYG-- 178

  Fly   140 DWLIVTRVLMGLGEGTTFPALSVLLAAWVPANERGKLGALVLGGGQVGTIMGNLLSGVFIDAYGW 204
             .:|..|:|.||.||.|:||...:.:.|.|..||.:|......|...|.::...|:|:.:...||
 Frog   179 -CVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGW 242

  Fly   205 EFVFYFFGGLGVVWFAIFMFLCYSDPTSHPFIKPSEREYLVKEIGTISRNEDLPP-----TPWKA 264
            ..|||.:|..|:||:..::.:.|..|..||.|...||.|:.:.||. |.| .|.|     |||:.
 Frog   243 SSVFYVYGCFGLVWYLFWILVSYESPAKHPTITDEERNYIEESIGE-SAN-ILGPVEKFKTPWRK 305

  Fly   265 ILTNLPMFALVAAQIGHDWGFYIMVTDLPKYMADVLQFSIKANGLYSSLPYVMMWIVSVGSGFVA 329
            ..|::|::|::.|.....|.||:::...|.|..:|..|.|...|:.|::|:::|.|:....|.:|
 Frog   306 FFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIA 370

  Fly   330 DWMIRRGVLSTTNTRKVMT--GLAAFGPAIFMVGASYAGCDRVLVVVLFTICMGLMGAYYAGMKL 392
            |::..:.:||||..||:|.  |.......:.:||.|::   :.:.:....:.:|..|...:|..:
 Frog   371 DFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHS---KGVAISFLVLAVGFSGFAISGFNV 432

  Fly   393 SPLDMSPNYAGTLMAITNGIGAITGVITPYLVGVMTPNASLLEWRLVFWVAFGVLCFTAVIYCIW 457
            :.||::|.||..||.|:||:|.::|::.|.:||.||.:.|..||:.||.:|..|.....:.|.|:
 Frog   433 NHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKSREEWQYVFLIAALVHYGGVIFYGIF 497

  Fly   458 ASGEVQPF 465
            ||||.||:
 Frog   498 ASGEKQPW 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmGlutNP_620115.2 2A0114euk 25..463 CDD:129972 147/449 (33%)
MFS 77..458 CDD:119392 130/389 (33%)
slc17a6XP_004913390.1 MFS_SLC17A6_7_8_VGluT 74..498 CDD:340940 144/445 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.