DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SrpRalpha and CPFTSY

DIOPT Version :9

Sequence 1:NP_524887.2 Gene:SrpRalpha / 47251 FlyBaseID:FBgn0010391 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_566056.1 Gene:CPFTSY / 819185 AraportID:AT2G45770 Length:366 Species:Arabidopsis thaliana


Alignment Length:314 Identity:86/314 - (27%)
Similarity:147/314 - (46%) Gaps:50/314 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 SLADLQPALEKMRDHLISKNVASEIAAKLCDSVAASLDGKQMGTFDSIASQVKEALTESLVRILS 375
            :||:....|:::.:.|:..:...:|..::.:.:...:   ..|...| .|::|:||.||::.:|:
plant    89 NLAETDRVLDELEEALLVSDFGPKITVRIVERLREDI---MSGKLKS-GSEIKDALKESVLEMLA 149

  Fly   376 PKRRIDIIRDALESKRN-----GRPYTIIFCGVNGVGKSTNLAKICFWLIENDFNVLIAACDTFR 435
            .|          .||..     .:|..|:..||||.||:|:|.|:...|......||:||.||||
plant   150 KK----------NSKTELQLGFRKPAVIMIVGVNGGGKTTSLGKLAHRLKNEGTKVLMAAGDTFR 204

  Fly   436 AGAVEQLRTHTRHLNALHPAAKHDGRNMVQLYEKGYGKDAAGIAMEAIKFAHDTRVDVVLVDTAG 500
            |.|.:||...          |:..|..:|  ..:|....||.:..:|:|...:...||||.||:|
plant   205 AAASDQLEIW----------AERTGCEIV--VAEGDKAKAATVLSKAVKRGKEEGYDVVLCDTSG 257

  Fly   501 RMQDNEPLM-------RSLSKLIKVNNPDLVLFVGEALVGNEAVDQLVKFNQSLADYSSNENPHI 558
            |:..|..||       :::.|::. ..|:.:|.|.:...|...:.|..:||:.:.          
plant   258 RLHTNYSLMEELIACKKAVGKIVS-GAPNEILLVLDGNTGLNMLPQAREFNEVVG---------- 311

  Fly   559 IDGIVLTKFDTIDDKVGAAISMTYITGQPIVFVGTGQTYADLKAINVNAVVNSL 612
            |.|::|||.|. ..:.|..:|:....|.|:.|:|.|:...||:..:..|.||::
plant   312 ITGLILTKLDG-SARGGCVVSVVEELGIPVKFIGVGEAVEDLQPFDPEAFVNAI 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrpRalphaNP_524887.2 SRP-alpha_N 27..268 CDD:282006
PRK14974 258..613 CDD:237875 86/314 (27%)
SRP54_N 299..374 CDD:214941 13/62 (21%)
SRP 396..592 CDD:239389 61/202 (30%)
CPFTSYNP_566056.1 PRK10416 48..365 CDD:236686 86/314 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D804839at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100631
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2595
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.