DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment woc and ZMYM5

DIOPT Version :9

Sequence 1:NP_001097946.1 Gene:woc / 47249 FlyBaseID:FBgn0010328 Length:1703 Species:Drosophila melanogaster
Sequence 2:XP_011533611.1 Gene:ZMYM5 / 9205 HGNCID:13029 Length:696 Species:Homo sapiens


Alignment Length:568 Identity:116/568 - (20%)
Similarity:185/568 - (32%) Gaps:175/568 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 DRKSPADAAADPEDDSAAAVDATDVSP---------------TTPTDAQAGAKSAATGIAEADGV 385
            |::||:....:     |.|....::||               |..|.|..|..:.||.:.     
Human     2 DQESPSSLCRE-----ALAEIKKEISPLFIGMEKCSVGGLELTEQTPALLGNMAMATSLM----- 56

  Fly   386 AAAANEEEAGGDVPDPDEPTAEESSSAGAGEPGSTPKIIISWIVGSVQ----KCKQCGDEKNCGF 446
                   :.|.....|..|....|.::...:......::   .:.|:|    ......|::|  |
Human    57 -------DIGDSFGHPACPLVSRSRNSPVEDDDDDDDVV---FIESIQPPSISAPAIADQRN--F 109

  Fly   447 RYRSPEESEEMDKEKENDKAEEN---AEEGEEEEARQKPAAPSGFEYICDTACVDALLEDQPGKY 508
            .:.|          .:|:|.:.|   ......:.|.||       ..|.:|..:|.         
Human   110 IFAS----------SKNEKPQGNYSVIPPSSRDLASQK-------GNISETIVIDD--------- 148

  Fly   509 FVRRKKFLVEEVVREEGAAEAEASADGE----GGDAEEEATPANTQDCLQCKDKTRCKYFIKQDQ 569
                     ||.:...|.||.::|...|    |...:......:|....:.|.||..:.|     
Human   149 ---------EEDIETNGGAEKKSSCFIEWGLPGTKNKTNDLDFSTSSLSRSKTKTGVRPF----- 199

  Fly   570 DCFYICNDDCFNLL-----NAE-----EPDKFKLKRHSIRVRNIGATTLQPPQNSPTKRTDG-SV 623
                  |....|:.     |.|     .||.:..:..|.            |.|......|. |.
Human   200 ------NPGRMNVAGDLFQNGEFATHHSPDSWISQSASF------------PSNQKQPGVDSLSP 246

  Fly   624 VA--RTVEEAETARLDRIESFRRRCADCEADINTDEKQLMWETMDFCNEVCLGSYQRTIGSTCET 686
            ||  |......||:....:..:..||:|:..:...:.                :|||. ||    
Human   247 VALLRKQNFQPTAQQQLTKPAKITCANCKKPLQKGQT----------------AYQRK-GS---- 290

  Fly   687 CKQEVSSIALGKYCVRFGFDVRQFCCAGCLNTF--KKGLKTCS-CCQKDISGGQEGFLAPVGDKD 748
                                ...||...||::|  |:...|.| .|:||.|..:...:.||....
Human   291 --------------------AHLFCSTTCLSSFSHKRTQNTRSIICKKDASTKKANVILPVESSK 335

  Fly   749 QFKDFCSQSCLRRYESMCNPRRKLRTDV-----CGVCNNQKPVRVEMLLEDREHYFCSNPCFSAF 808
            .|::|.|.|||    |.|.....|:..|     |.:|:....:|.|:.:.:..|..|||.||:.:
Human   336 SFQEFYSTSCL----SPCENNWNLKKGVFNKSRCTICSKLAEIRHEVSVNNVTHKLCSNHCFNKY 396

  Fly   809 KFVSNVNADPCAMCSKYFERRS-AESYTIYNEQQSPKVFCSRVCINVY 855
            :..:.:..:.|..|.:|...:| ..:..:...||  |.||.:.|||.|
Human   397 RLANGLIMNCCEHCGEYMPSKSTGNNILVIGGQQ--KRFCCQSCINEY 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wocNP_001097946.1 TRASH 684..721 CDD:214799 5/38 (13%)
zf-FCS 724..762 CDD:283998 14/38 (37%)
DUF3504 1531..1690 CDD:288835
ZMYM5XP_011533611.1 zf-FCS 268..303 CDD:283998 12/75 (16%)
zf-FCS 361..396 CDD:283998 10/34 (29%)
zf-FCS 399..442 CDD:283998 12/44 (27%)
ZnF_TTF 590..665 CDD:214739
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D266757at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45736
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.